SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008853 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008853
Domain Number 1 Region: 2-240,286-312
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 9.42e-66
Family Tubulin, GTPase domain 0.00000788
Further Details:      
 
Domain Number 2 Region: 317-493
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 1.95e-53
Family Tubulin, C-terminal domain 0.0000621
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008853
Sequence length 515
Comment protein Name="PYU1_T008853" Note="Similar to Tube1: Tubulin epsilon chain (Mus musculus)" AED:0.100261199224467 QI:0|0.6|0.16|0.83|0.8|0.66|6|0|515
Sequence
MPRELITVQVGQCGNQIGRQFWQLALEEHAQHLTSHPRASNPLAQNSKKGRFDESMSTFF
RNVDTRYADPMDLPFANGRSAVKSLKARAILVDMEQGPVSETLAGPLGELFDQQQFLTDV
SGSGNNWAHGHCLYGPKYRDELLQKIHRAVELCDSLQSFFVIHSMGGGTGSGLGTYILGL
LEDHFPEVYRFTSCVFPSEDDDVVTSPYNSVLALRELTEHADCVLPIENEALMDMCAKID
KSSSSSVQFSSLADTSMSLSTPAVVNGSRLSDHIDLKALEHLSKPNQASSAFGEMNNIVA
RLLTNLTSSMRFEGSLNVDLNEITTNLVPFPKLKFLLSSMSPMFATVDPRQQPRRLAQMF
SDAFQKDHQLIRTNPRSSVYLACGLLLRGNVEISDINASIQRIQSEVRMIHWNQEGFKIG
LCSVPPIGQKQSLLCLSNNCCIRDTFERLRDRFRKLYVRKAHVHHYTEYMEAERLSEAFE
NVRFLIDEYVKLENSAHQLDAAPVTATSRRLQPLL
Download sequence
Identical sequences K3WV56
PYU1_T008853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]