SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009277 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009277
Domain Number 1 Region: 96-209
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.00000000000000314
Family Calcium ATPase, transduction domain A 0.002
Further Details:      
 
Domain Number 2 Region: 14-55
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000824
Family Calcium ATPase, transmembrane domain M 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009277
Sequence length 248
Comment protein Name="PYU1_T009277" Note="Similar to Sodium/potassium-transporting ATPase subunit alpha (Taenia solium)" AED:0.172690763052209 QI:0|0|0|0.5|1|1|2|0|248
Sequence
MKDVKDYQRPAALADFIAQVGVDPSTGLSRDDAMARRALYGANRVTPPVNCPSWVCCLLP
CLLRTSSMQAYHAVLPKEATVRRKVAASGKGATTRRMRMDAMSLVYGDVVELQPGDLVSA
DMRVIECSSDCLVDQSALAGNEDHDDDMEEGERSCVRKHVSPVDAALEDGDNDPLTSRNI
LLMASRVVRGSAVAVVIATGDRTFWGQLVAHHEWSVPASTFKRTGQHEEHRRLVKHSATK
SKSAEIIV
Download sequence
Identical sequences K3WWC9
PYU1_T009277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]