SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009445 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009445
Domain Number 1 Region: 17-147
Classification Level Classification E-value
Superfamily DNase I-like 0.000000256
Family DNase I-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009445
Sequence length 286
Comment protein Name="PYU1_T009445" Note="Protein of unknown function" AED:0.0468421052631579 QI:2|0|0|1|0|0|2|1|286
Sequence
IQDITETQVSDRNTLSRYLVLQGTLDGSPAYIHAVYAPVNPTDRPSFFDSLPRQFEENAI
HMALGDFNTVFSTQLDQAQTNNRARREGRQELLEWMQALNLFDAWRLQNPMFANLRVPTE
VLLKQLKHDWKHQPNKADHCGIEFTLGSELFKPRTRAPWRCPSWVIELPEAQEYLKLSLI
KLAESIDPTITSTYNPGYLLDEHKRQDCIYLRQLFNEKKNKRQVEKEDLHMRINQLQHLQ
HLSPSQEVSTTLSSLQQKLRVHIEEEDHHKSKQKFASDLYQSEKCT
Download sequence
Identical sequences K3WWU7
PYU1_T009445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]