SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009514 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T009514
Domain Number - Region: 317-378
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00095
Family Cgl2762-like 0.027
Further Details:      
 
Domain Number - Region: 520-560
Classification Level Classification E-value
Superfamily Homeodomain-like 0.034
Family Cgl2762-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009514
Sequence length 658
Comment protein Name="PYU1_T009514" Note="Similar to sdrI: Serine-aspartate repeat-containing protein I (Staphylococcus saprophyticus)" AED:0.657976006558981 QI:0|0|0|0.66|1|1|3|0|658
Sequence
MEKTQAEAAAEAALSASARAAEQESTHTDDKDGDHQDTDVQEPAVAEASGPDASSGGDTE
RQRRLESFELLDAAMDNVVDDDGSESADGQQESKEASEQQQDVGADSGGSQPVEAEQDIV
VTEVQQVVPNVNSSAGHKVDVVEAQDAVVDEVSDMGHEPAAQALALADGVGNAHPVELTF
VGAQRAPVEMNAMEENTRDATDQSVPMEPVSATSSEHIVAASELPITHGLVSGFEKYEPE
LLQWMQECQRNNHGLPASHDDVLFFMETKYPEFLENVAGLFEWLTQFLAIYNQMLATRSS
GITDMVDPEITLVQQFDRFSDEFKLSAIQQLEETGDLTTVANEFGLKSTTTLVYWKYLRD
NNGQLPASKGEEATEQGRRPSFSQEQHLLEWVLSHRETPITKQDIFSHMISAYPEFAVTK
TAAALKMWITRFLKRHLSPGITASKDLMSALPVVEGLGIESESDLPDNAVASGLQDSIAA
VGVSQVPTSKPPATASIPPTPVPQTKRREKRGCPDGYVLHSNEFKLNALRKLDEGKTISE
VTEELGLKSQNTLAYWNSIRDKLATSEKKRFRLAGGGRRSSCTFEDELLSWVTERHQKGE
GTDVKAVLDYMREFHPAFTDGKKEPTLRKWILRFFKRCLRTPSTTSGSGDVEKSCIFV
Download sequence
Identical sequences K3WX16
PYU1_T009514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]