SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009956 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009956
Domain Number 1 Region: 320-553
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 5.47e-38
Family ATP-dependent DNA ligase catalytic domain 0.0000148
Further Details:      
 
Domain Number 2 Region: 583-747
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.42e-37
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.000031
Further Details:      
 
Domain Number 3 Region: 31-296
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 6.02e-27
Family ATP-dependent DNA ligase DNA-binding domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009956
Sequence length 757
Comment protein Name="PYU1_T009956" Note="Similar to lig1: DNA ligase 1 (Xenopus laevis)" AED:0.212401055408971 QI:0|0|0|0.33|1|1|6|0|757
Sequence
MLRAWGSGKKTRFPSARLRRRYFSSVSSSNDEQTHNTTQEQFPFSELARTFAAIEQVKQS
RDASVRLLATCFRDLLRRPSTPNDLASALYLTASQLAPAYEGVELRFGMRYFAPIVAQLV
TDASGLSAGGDNHSETLNMTQFPDFGTAVQSLIDSGHIRIRPHDVNTDNSSQETDGSPQI
SSISFVHQELLRLASEEGNGAVIRKQQRAVQLLKQCRSTEEMVFLVRMLAHQSLRIGMGE
KSILAALAMASAPEPNIQEKQELAEPSLPFPLKQWTESVTKAYAQQPNYAALASLLHANQ
REQDLTKKIEWLNAHASPTVGVPVLTMSAYPISSVEGVIDRIQKTSSKTASCEYKYDGAR
VQIHLSLGGDGTQVVGRIFSRNMEDNTEKYGSLLDVLQRQLKNGVNELILEGEVVAVDRA
TQRFLPFQVLQTKTTTDFCLFAFDLLYLNGEKLIDRSLRDRRTLLRECVSEQAGYLEFVK
SLDIDLNAAESSLTEEDQVAALMHNAGVVRDFLQEAVGAGCEGLMVKALEDASDYKAGVR
SYSWIKVKQDYLSDSSSLSLDAISTGAKRKPRPQADHGAFLPDTLDLVPIGAFYGKGRRS
GVFGSFLMATYNSSTGKFETIGKVGSGFSDVQLSQLSERLRERHVLQNDGTVPENVHSGQ
IRSRQPDVWLSPDEVWEIKATQLTLSPSYTCASLPTDEEDDGVEVNTGEGVSKGLALRFP
RFVRYRPDKNPEHATDSSQVAELFRQQTVNQNGQHDQ
Download sequence
Identical sequences K3WYA7
PYU1_T009956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]