SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010097 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010097
Domain Number 1 Region: 369-504
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000597
Family Fibronectin type III 0.0048
Further Details:      
 
Domain Number 2 Region: 568-625
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000837
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010097
Sequence length 810
Comment protein Name="PYU1_T010097" Note="Similar to DDB_G0271670: Uncharacterized protein DDB_G0271670 (Dictyostelium discoideum)" AED:0.0563005094552254 QI:0|-1|0|1|-1|1|1|0|810
Sequence
MRRRSTYPFRLRAAALAVAIACVVCSSTAHVAVASVQESEITSLGKLALNGDTAPAEHPE
SVQPPPTPAPSPSSSSLSSSYSSSRDADAAVVIRVPIDLEDLVDDGSASSSGFSSSLSPF
SSQDAEADAVARVPIDLQDVMDDESASSGGFLSSSSSSQDASENDVGGSSWSSSSEQDMT
YDRSASLGSVASVTISFSSSSSSSSDSAGSTSANDVVLSDKESLSNNGTESGYEDMSASG
SRKDKNDTIVFLLLSSASASGSESSSSVQIDDMEIVTNSSNATLSSSSDGSDSSSARLTN
FTILTTELDSKKHNSSTIHANQHLASPDAVTKSDDPVTLQVLALSTNSADSDSDNTSDDV
SAEASSPATTAVLVMHGVPSNPTMVNAVAYDGRAEVSWKAPEDDGSDPVTEYEVGWFDEE
ENVLVGSQFVTQVTATFNAAANGSSTVPSDAGTVPTSSVVTHLLNGRSYTFKVRAKNVNG
YSVWSAKSLAVSPLHPPDLCGRISCSGRGTCFPNYHSERAGQYKHKKRSLKRTDTVKADE
TSSLDAQCICRPGFHPPDCSVKDEATQYVWKVSEWSECNSGCGGGKRTRAATCFDITTEK
QAPSEELCSVPKKPSLTEICNGMECGSKLVSVKYEVEMSYDEVLFSPESVAAFELAFTTE
VSAALQIPSTRIEVTALKRGSIAVFFQILPASRVGEKSLNDIVEKLQDELNNATSTLRSK
GTFARRVEPNGVKLSFSIADQTVAGGAEDISILGLIGTVLVLCFFVFMFGWFLRKRHHRI
LKHEQDRNRPERVLDATQSEMKRMGIRTMA
Download sequence
Identical sequences K3WYP8
PYU1_T010097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]