SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010114 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010114
Domain Number 1 Region: 86-312,346-362,407-435
Classification Level Classification E-value
Superfamily DNase I-like 3.12e-32
Family DNase I-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010114
Sequence length 449
Comment protein Name="PYU1_T010114" Note="Similar to CCR4: Glucose-repressible alcohol dehydrogenase transcriptional effector (Kluyveromyces lactis)" AED:0.0392982456140351 QI:0|0.6|0.33|1|1|1|6|0|449
Sequence
MTGSANPLAVYVGMGVALLASVSIGRHNQRVWKSLQRLSSGSSAAGRGRRSVTSLAAKDG
AVGSTQRLLKCAQQLQQVGEDKLSRKTITVVQLNILASNLATRNHFPYVVDSSLNWENRK
MVLLRQLEELDADVVCLEELSDYWTFFKPELNDRGYDSVFVKRPSIHVSNWSGEKKHDGC
GIFYKKDKFELKECESVNFHDPHDRVAILALLKMRHFAQFVLVGCTHLWWNAKKVDHQMS
ELFEFEEEVIRMTSDVMDKYERDMADTVTGKNHLPIVLCGDFNNSPESAIYEYMETAFMQ
KPNLEGVTETFKSAYAKYKQNALSSGVYDEASLHIKAGKKDEPPHTTVNYRRCWTIDYIW
YSQSSLVPAKILDIPDESILRSEEGPPNWLNRLALSDSYNKSGRLPSGLHGNHNGIPNSK
FGSDHVPIMAEFEFLRTNTEATKAGDASA
Download sequence
Identical sequences K3WYR5
PYU1_T010114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]