SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010291 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010291
Domain Number 1 Region: 561-748,1112-1192,1284-1346
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.16e-100
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000674
Further Details:      
 
Domain Number 2 Region: 378-400,437-508
Classification Level Classification E-value
Superfamily DUSP-like 0.000000000000275
Family DUSP, domain in ubiquitin-specific proteases 0.0046
Further Details:      
 
Domain Number 3 Region: 122-242
Classification Level Classification E-value
Superfamily EF-hand 0.0000000515
Family Calmodulin-like 0.0082
Further Details:      
 
Domain Number 4 Region: 2-85
Classification Level Classification E-value
Superfamily EF-hand 0.0000144
Family Parvalbumin 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010291
Sequence length 1386
Comment protein Name="PYU1_T010291" Note="Similar to USP32: Ubiquitin carboxyl-terminal hydrolase 32 (Homo sapiens)" AED:0.268489097472392 QI:0|0|0|1|1|1|2|0|1386
Sequence
MDEFLRAVAILRCGSMDDKIMFVFHMCDLDHAGKVQSTGLSNFLVSLHGRQILERPEYRR
LLSDGFDQGRARMSMEEFAKVVPELEACSILVDWMDPFVDILCETANPQLLESQEEFNPV
VQQKILANETRFSIKEVSILQDAFNNYRVSGGGDAVDMDALTSDFPLEMSEERFARVFSS
FGSRATGTDIDVFSFVNALAIACRGTTEEKAKFAFTLFATLSSDTLMSRDDLYGMLRLDL
AQNSDLEDHVLTFIEENVKTRSYSKSMTASSKSLVDLIDGRIPSVSGSELGIFVDHIMKK
YGKERVIFESEEVAADETPVLTLTLEEFTACTKQEHYEMASLRIMREVAFIDLGLVPEDK
EEELRVAKGCYKEYEPSALVEDDQWFLIEAKWFDHWCKYIKLPVSEVEPPASNSGIGSAT
SLADLQSKLTVANTAKTSKDPPIMDADGNYLRPKGINNYLLLTGDRRDRVLKSADDIKLG
KHFVVICEQLWMALKLWYGGGPEIRRAVVMQSNGVPILDIWEDALKKKKDEEDDDSTTPS
DGEKQKKIDALALPRRMRSGGSVGLSNLGNTCYMNSALQCLSNTQLLAEYFLSGMYLDDI
NRTSTLGLQGKLAEVFGKLAEDMWCAKQKSISPRNFKKTIGKFNEAFRGSDQQDSQELLA
FLLSGLSEDLNRITDKPYVEQPDSDGRYDADLADEWWRNHLRREVSIIVALFTGQYKSLL
TCSVCGFKSARFEPFTFLQVPLPEPTHNTVTVLLVLANGMTPMKVSVRLTISATIFDLKH
ELMNMCHTEFDLPNITEADIKLCEFSGSMILSFKADNRRIGQIRSIDRLIAFQLEPLDTD
IAQATRHRRPSYIPTGPGATRVEEVESEKYQKFYENLTKGALVEVRTRAQSHDFVPGVVI
DCPENPTAKEDDEPQILVRLRRGDEEMMVPLNRLRPRQARLLYVPLVSRKLSYSAVYFKN
PFRPMPFGIPNLVRICPERTTGYDLYKLVWERVKDYVKAPAPKIWDEHILQNTNALVSNH
IDDIFSGLNASSGFLLRRVENKGLTDARSSWLTRSFGFTIPCTNDLLDIMEEETIAIDWD
LQVFQDRVLIDRMKHIESHSSVAKNEAIDKGPVPLKHCLDAFTSEEKISEGYCSSCRTHV
EMTKKLEIWRLPPVMVVHLKRFQYTQTYRRKLASLVEFPIEGLDLSCCVAPHEEFPEKYP
MKRSKDEPVKKAVESKTNGAATENGTDVVAKPDAPETDTAKVGDKAEENAEPSTVPRTGS
VPNAKVMNRARRGYTNTNLDQSRCLETNYDLYGVVNHQGALGGGHYTAYAKNFVDDQWYY
YDDERVRVVEESRVVSPSAYLLFYLRSDMKGMLVKDMFPQNKNGKITEEDIERFVDQGDE
RRCTIM
Download sequence
Identical sequences K3WZ92
PYU1_T010291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]