SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010294 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010294
Domain Number 1 Region: 182-529
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.91e-30
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.016
Further Details:      
 
Domain Number 2 Region: 7-135
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000404
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 3 Region: 766-802
Classification Level Classification E-value
Superfamily UBA-like 0.000000255
Family UBA domain 0.021
Further Details:      
 
Weak hits

Sequence:  PYU1_T010294
Domain Number - Region: 718-766
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000427
Family PDZ domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010294
Sequence length 804
Comment protein Name="PYU1_T010294" Note="Similar to USP53: Inactive ubiquitin carboxyl-terminal hydrolase 53 (Homo sapiens)" AED:0.0084642050662338 QI:0|1|0.6|1|1|1|5|0|804
Sequence
MQATALSSDDGPLLSAFGEIVHRGWLNLKTRSMVNVRPRHMRYCILAKDSNVLSTFKFQP
STGDLTSGNVKPLKSYKVLGVAPWDGRRFAFLISVIQPIDNTDRVLEVDAPVAQAASEWI
HHLRILVNGADDNWPSSTPNTVAFQGSRSFTSGTSNTSDTSPNTSTSSKRSHDMWVKGAS
VHRGLLNASGENSCFLNVIIQSFWHLTSMRHFLLHVEIKDGTRTVEANVLRALKTIMMEY
DDTSSGVIHSRGLRKGLSVLYAADKNFQEGAMYDAEETLLALLNLMHQQTNATDISETQK
TTAMVKSLVRLVSHETYEVEDKSRAVFDEHSIPHLVFSHQIYDRYTCNTCHRTTPWDLYS
NLIFTTYASDLYKQKYESMEHMFRQISLQDADVAPSCDVDGCKGKHTKERVIHRFPMVFT
VSVLWATNSATKDQVHGLLLNIGDRVDLAKCFDAAGPVIKFKLGGIRTTYRLRGFVCYYG
RHYVALFYSTAHKMWLLFDDSRVLEIGSWDNVISECLKGRFQPVLFFYELPDQRKDSSVS
LFSMSGGDTSIAAAAAESRKKSLSFSSMQGDLTIPESPDEETADSPLPRKKPLLRVEEEP
APALFGGAPADVVPPAAPTAPIATTSVGAMRMVESDREFELGEMKRRGSISRINIMPVSA
AIAMMPRTISMNAPLGDGEYDVQFGDDTVVLGMYLEKVGTDLCVTSFPRGVHDEMFGAEK
SGQIGLFDLVLQANGHPLQHYQVDRALKMIKAQSRPLVIRFRRSPRVASLTDMGFSKELA
CQALAKSSGDVQAAVNLCFEMRQS
Download sequence
Identical sequences K3WZ95
PYU1_T010294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]