SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010484 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010484
Domain Number 1 Region: 2-82,232-362,392-410
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.87e-33
Family WD40-repeat 0.0022
Further Details:      
 
Domain Number 2 Region: 368-519
Classification Level Classification E-value
Superfamily Fibronectin type III 4.39e-23
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 3 Region: 779-1004
Classification Level Classification E-value
Superfamily Fibronectin type III 2.64e-21
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number 4 Region: 600-682,720-760
Classification Level Classification E-value
Superfamily Fibronectin type III 1.95e-18
Family Fibronectin type III 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010484
Sequence length 1049
Comment protein Name="PYU1_T010484" Note="Similar to FNDC3A: Fibronectin type-III domain-containing protein 3a (Homo sapiens)" AED:0.0844209288653733 QI:0|0|0|1|0.5|0.33|3|0|1049
Sequence
MLATCSWDSTCMLWKIHDNASSCQQDTDMAAASTTLTLLHIFPVHEEGASYARFTFDDQQ
LVAVGECVVKVWDVSTAAPVSPDSSADCEKLWSSEGRRIEAERAVWEAAMPFELTPQRSM
ELFMFDEALLSMVGNHEWQYFREHDANKTEQLERYYKQLTQFDFELLLNPAIPFPGQLGN
NTNQSGEGNNAETRLPSTAAITPKELVWNSLRPDADGKLLRTFTKVDDNGFFVAHTSAIT
CCAVAKQVDMIVTVALDKCIKFWSLTQGKVLETIRNAHAAPITCCALTLSSQETTVTRMD
LMLATGGKDNLVKVWRQRENGASTECIYTFCGHYDAIACCVFDPSGVFLTSAGDDTNVIT
WRVVPSSPDQPKQPALVSTDKFAITIAWDEPLANGSQLLHYVIHTKQTTSLVEGGHDIVG
ILESKVSAKYTTKTVEKLQPGIQYTFQLAAVNAIGTSPFSEATLPIETLAFVPSQIEQPV
QYSDREAVCIRLSWKQPNANGAFIQSYTIRCVPENSVFVPALEMSIPSTDLEPAAPLAST
DADIIGKKKATLTKGQGKTKRKKETALTGPREAKTMVAGSGSDVKAIEPKSQQKLPSASI
FYSVVVERLWPGEIYQFVVAAENRCGLGAFSRVSDYVKMDCIAPDPPPQPVIINIQKRQV
DIVWEKPRCNGSEILQYTLEWVQYDQVKSIVVPGARNDNNSGTTSSYESAEAVVPDPVLL
VSNSIVLLTRSIPGTSYTLQGLEPGQPLRVWLSASNLIDNKICTSELSCASEVATTLCDV
PDTPARPALIQPSAHTLLLVFTPPKCNGLEIQSYDVTTYFEEVQFGITNRQVFREFKLWI
SDCEAIPNAGFASAFTIKKLRGSTYYSAELRAINELGASATSECSALVSTKPPTVPARML
EPPVIRDIEPGRARITWAIPEYDGGAPLLAFHLQYSAQPNSTYSLNADNLGENIYKALFD
QEVTIYHGQELLATFLRPKTTYRFRVASSNAVGKALFSKKSVAIHTPSLVEFTVTNYFAD
RPELEHVKARYIQVTQVFSFFAKVVWNGC
Download sequence
Identical sequences K3WZT5
PYU1_T010484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]