SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010572 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010572
Domain Number 1 Region: 171-385
Classification Level Classification E-value
Superfamily DNA-glycosylase 1.13e-32
Family DNA repair glycosylase, 2 C-terminal domains 0.0000256
Further Details:      
 
Domain Number 2 Region: 61-170
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 2.35e-19
Family DNA repair glycosylase, N-terminal domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010572
Sequence length 425
Comment protein Name="PYU1_T010572" Note="Similar to OGG1: N-glycosylase/DNA lyase (Homo sapiens)" AED:0.0492957746478873 QI:1|0|0|0.66|1|0.33|3|2|425
Sequence
GTKRKASTVAASPEPPAYVRIKAELPTTKNNHGNIHVKHETLASIPVKTEEEGDASGGAL
QWHRLCSPQELSCKLTLASGQVFSWQYHAHACEWSGVVGNYVFALRENNQIVEYRCLHPL
QLPPQEAHAILTHYFRLDTEAAPLYQAWTTLDDPMAQLIRSLPGHRMIRQDPVECLFSFI
CSSNNNIQRIQQMVGKLRATYGTHLCTVDAVSLMPISPDSKLSSSKEVAAISYYSFPSPE
TLTTKCEEATLRTLGFGYRAPFITKSSQQLVALGGIEYLHQIRDWKPQKSADVNAIDEMD
EYQAKLMVFAGVGRKVADCIALFALERLDAIPVDTHVWQIACREFDPSLVDKKSITPSVY
KSVGDHFRRRFSPFAGWAHSVLFTGDLTAFQSHLPTDMQKKKKNVKTQVKKKVVGRIKAP
GKKAR
Download sequence
Identical sequences K3X023
PYU1_T010572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]