SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010600 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010600
Domain Number 1 Region: 1-132,251-343,375-395
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.18e-58
Family CAF1-like ribonuclease 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010600
Sequence length 569
Comment protein Name="PYU1_T010600" Note="Similar to parn: Poly(A)-specific ribonuclease PARN (Danio rerio)" AED:0.0169012647898816 QI:0|1|0.75|1|1|1|4|0|569
Sequence
MNVTRHNFEACFADLKKDIELPTCRFVAIDTEFTGLSPNEDKKERFLDTLEERYQKVKAA
GESFLITQFGLSTVHIDDDEQFQIKTWNFYIFPRPYGQTDHRFLCQASSLQFLSEHGFDF
NKFIADGIPFLNLARTKGLKKRLEKRIEMLHKPAKGNLSLSEEGSEFQADVTAQLDAWLA
DGAKKGSKLVVPTRNSYYSMIVHETVREKASYLYSEAVTSGGVEVSFVSQKIKQELIAAK
VQAMKDELDQAIGFSRVIDVLSKSKKPVIGHNALLDFVYVFNQFYKPLPPTLAEFKEELV
KLFPAIYDTKHVALRSSGLMEKLQSTGLSSLFEYMREHVKPTPETLLSSDPRFDGYRAAL
QAEGDADDSTKLLCHEAGFDAFMTAVCFLGLLAHDAQGGLVEDASVGSVARLNERLAELD
AFKNQLNLMISDERYLDLTNVAQTIDRSRVVRVSSSKRKLHQVRMEDLFLQTKVQRVLRE
GEQDAFVVLADASYELNADASAEDLTITTYAQFIASRKAQADAEKTAANQKLLAQLQTEY
PEDKTAATPFAGLVPTAENSSSWTRCTIS
Download sequence
Identical sequences K3X051
PYU1_T010600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]