SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010743 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010743
Domain Number 1 Region: 263-379
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000493
Family Pleckstrin-homology domain (PH domain) 0.0093
Further Details:      
 
Domain Number 2 Region: 1-42,81-161
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000906
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 3 Region: 658-757
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000000000115
Family Ypt/Rab-GAP domain of gyp1p 0.016
Further Details:      
 
Domain Number 4 Region: 484-637
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000000366
Family Ypt/Rab-GAP domain of gyp1p 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010743
Sequence length 866
Comment protein Name="PYU1_T010743" Note="Similar to Grtp1: Growth hormone-regulated TBC protein 1 (Rattus norvegicus)" AED:0.0173711886426211 QI:0|0|0|1|1|1|2|0|866
Sequence
MEGVLWVRISRGKLLRGWQKRYFILTDDGLLREFAEITEAPAPPTAAAGAVTATPASNKR
RFTTPPSGSLSSQDALVARSGMMLKEEIDVLGSTTKTMPFPLVGRQFVFQIMKKGVFRLS
LGAKSGEDMHQWMNALKAVASLPWADARRQRSPAISGRIPPSAPWTRSPSLEIGTSRTED
DFLDIPVLHPNDMAKFASGYEWVDERIKTTRDITLGGVSIPRGSILVAANGISLQTLAVD
EIKLMLKPSRGITSGLRFLRTPYKKGVLKCKMCFSLTTQLKTIAQYRNGLRDWKQQVVEV
DGEVLTCYPRADAKSNKARRLIPLTGGCTVKTVHEIVAEQKFCFMVSAKSYSMLFQARSD
EEVRHWTEVIQRSIHLAEGVLPGQHDRPSLDNMQLQSSLNMRNLQNSLDFLDADDQLYPV
TRQTSIPTDDEWETTSSDGALGSPVYPSSDNWDSATQRAAYLPANDLSEMLFFLQRSGRL
VEAFQLMGRNTSHRSEYWKKIFLWALDPIERDAFEHLLALPLADEDNVQVQKDIPRTSKW
LAGSSGAPKLSADASVIRLEHLERVLQAFLAGCTAHVRTDEKEEEATSSTAPREGSKNFY
MQGMNGLAFILLEVLEDELVAFQFFRGIISRILPHVFGICWEGTERDNFDLFSSLVEVGN
ILQDVVALHLPNFSGAMDDAGIPVCLLAYKWFPTLFSDISLMAHKTQLRFDTLLVIWDIC
LLMGLEGIFCVSLALFSTAEEHVVGLGRDASAEQISNALVHVISQIKPEDLVTSVCEVLE
LCSHPVLLKLRNGHRRRLQLGYAKQKYDGLCSQTPAAIGTASSTAKPGAMVPKVSPRMTV
KDLDSGKLFKISHTGNMLLPVMKAMQ
Download sequence
Identical sequences K3X0J4
PYU1_T010743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]