SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T010767 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010767
Domain Number 1 Region: 389-467,646-784
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.32e-34
Family Ankyrin repeat 0.0017
Further Details:      
 
Domain Number 2 Region: 104-137,264-296,403-548
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.23e-20
Family Ankyrin repeat 0.0024
Further Details:      
 
Domain Number 3 Region: 1059-1209
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000017
Family Ankyrin repeat 0.0054
Further Details:      
 
Domain Number 4 Region: 797-954,1060-1080
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000663
Family Ankyrin repeat 0.013
Further Details:      
 
Domain Number 5 Region: 19-137
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000482
Family Ankyrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010767
Sequence length 1247
Comment protein Name="PYU1_T010767" Note="Similar to ANKRD28: Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A (Homo sapiens)" AED:0.288538300179236 QI:0|0|0|0.66|0|0|3|0|1247
Sequence
MSIFQIHTPPQAGRPKSNDDQDDKGETAIHVAVSRGHLELLEYFATLAQYNFPKCFLREA
KKPISLLVTACKSYQTKALAFLLKAADTHNSDVRTGGFTYAENHDEFQSALNACASHQFA
EGFQLLIKHGARPDIQTLVSVLQGIGEPELPKALSAYLTPLDIKSARSLKKRKASSLLSI
ARGKYPVQSRRTVAKARALLQTVVVFADDFGAFFSTGASFDIILKVFIVCAQYELWFVFQ
RLFLNHATRFLDSTSIWKPAVIRAISCCLVLHRAALHNQVGLIRFILALGVPADLRLSEI
PTALSPIWYAATGGCVEAFISLALALQSQSLEALMKSVERGGSNFQLSVSFRSIQESKSV
FAPGSACKWQNLSAFSCYDIPRKQTRGFLIKKLISYARYNQRQPFKKNSLLHIACDRGDL
LTVQVLVENGADVAALNEVNETPLVLAAGRKDSFGNLIVQYLLTIVTGKGLDEIAVLSIN
RALVRCYEQPPPFNLKMAKMLLDAGAHVDFSESNKQSGCSKSAMYYALCSIQFSAVKLLL
DYGASLSIPLAEEFLHQFWMSDNHEARKKHWKHFAPLLASKHQRLLEVESLMRVLLEKKY
FSQTMNKNLLHQLIKSAAVLATTAASVRGLEKKFWGVVALAVDTYPDESKAQKDEWGGRT
ALHCAVAGLEVDIAAKLLDIGEYDVLAKDHNKQTSLHVAATKGDAQICELLLQNLDKRSQ
IFGVDAADCFGRTALHTAVIHGHEAIAGVLVNAGASTELRCERGYNALLYACKCNRLGIL
IALYTRNSEIARDLLATPAGEHGLFIAARCGAFQIVRWLLSVCKEELVSPTGSYGFGDMK
CLQQRSLLHYAAAFGDHGFIRLHLQQMAAKESQNPGDMESQLNIRDKAGVQALLTLVEYG
SNSDMSVDHLGEAKTHPYASSFNIGTLLQWFAFPGWYSYTSKMFPQRDKCRVTKQESIHE
DYLMNSSFRRWKTRRKTRAMVFTRSRSQANNVKTKITKAKSGAGKFENIRTSMRSWRFPQ
LSLFDFVCDVGDSVMVDFVVNMKVPLLLRRSTYQSQRRNMLQAVRWNRLDVVQLLISADA
STSGEQIEATNHTDGLHYLDFLEVGIDCAVSRGHEDIAIYLLTRWDDVRESGRKAVDAGM
FAFQFAHVLHIACIRRMTKLIEYMVSRGGEQLVAFHANDGSALVYAVAWGHMDVAALLAA
YGAHFSSMDTYIAPSVKKWVEFGCRQEIQLSCCFKGHIGFYYQRDEG
Download sequence
Identical sequences K3X0L8
PYU1_T010767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]