SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011118 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011118
Domain Number 1 Region: 296-503
Classification Level Classification E-value
Superfamily Fibronectin type III 2.19e-23
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 2 Region: 1023-1137,1309-1377,1455-1500
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 5.62e-21
Family Galactose oxidase, central domain 0.023
Further Details:      
 
Domain Number 3 Region: 891-989
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000534
Family Fibronectin type III 0.005
Further Details:      
 
Domain Number 4 Region: 1169-1209,1250-1300
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000425
Family Proprotein convertase P-domain 0.052
Further Details:      
 
Weak hits

Sequence:  PYU1_T011118
Domain Number - Region: 82-99,246-286
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000356
Family Fibronectin type III 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011118
Sequence length 1572
Comment protein Name="PYU1_T011118" Note="Similar to PE_PGRS20: Uncharacterized PE-PGRS family protein PE_PGRS20 (Mycobacterium tuberculosis)" AED:0.094723458359822 QI:0|0|0|1|0.33|0.25|4|0|1572
Sequence
MPDACVLILFLLAALFAHLSDAAQQYRVSLYNTERRVNAELVRVLPGNPGSAEVTLSWRS
FHNGLYGDSDLGHTDAVGNKDPVIAYEAQYAVSGSGNWVSLSQTITGTGTEKQPDLHEKQ
RIWTRADAGQTISDGFFRLTLAHVGFSALDVHQRIITPEIPFDANEAQMKAALESLDVIS
NVQVFRRGLGAGAYEWIVLFDPPMSTRIDHGDLPLLILYTETISATWSGPDDQVAIQSLR
EAELEQIVCADLCSYNVKNASTGGAFSFRVRAHFTRMGWSEWSIASAPLQIPTTRLPRSP
ARPEFVSATTSRIVFKWQGELAPATTAASLVILFPILSYHVQQKCDQDLGWNSVAEHLEP
GHTSFTFASSLARPPNSSCMFRVSATNANGIGPFSVPSLNFQTLPSVPDIPKSPSMMRHP
LQFSWKPPSSDGGAAIVRYDVQYRLVDSSTWIQVAPYSVDSVNCTFAFEDVTQLLSYSRY
AVRVKAVNAIGNSAFTTPEEFLTEYRVEHIESSPAVSPSSVVIFRNATRALAANTMDRYY
ANGIGTGGVRQMDGGHGLVVLFPINQRGEKQGELTFFFTSGKQVYQVPEKRTTDPMTRIV
AIDAYGWGAGGGSGGKTSNDDLSNGGGGAFARGVFRVSPADRFEVYVGGGGRGSGASRLG
AAGKGGFHGGGDAGKGDFSGGGGGGASEVRINGKTIVVAAGGGGGGSTDYCCAHGGGGGA
GSGVAEEGNAPNISSIPLGLIEFQHTMRDEYHFENILGDVLDFTYARARHAHLDFGFAGP
DADYSVLATGGAGKYVMNEVNSIMEISAPFIASSASSGRRMYGGKGEDGKDGGGGGGGGY
FGGGGGGAGVDGGGGGGGSSFISFANLYDPSEQAKSRITSAWTQAGDRAESFQVKAISST
AVELSWMPPRYGYSHGADGFVIEMANRSMNEDFRIVRLETNAADIACMTMRKSVVRDLAP
SSWYRFRVKVLFRDDSGKYSEIQTIQTRAIPRNVWRRVTGGVRGFSAETTGAGLWFSDPA
PLRRLPSARRGHSLLFFDKFLYLFGGYGRGYLCNRAHQSTCILNPGVNNELWRFDLQTRI
WMEVLPESPNTVVLPPAREKHSAVVVGDRVLVFGGRNADTDETKASFNDLWELSISSTTA
RTTTSLRDLETNVALNDGKEAFTMGNVGSAPDMCVTNMTVQLRITHSCSQTLHIQLFGPG
GSKRETAATVSARSFPATLQSPSMWSANAPCVSGSQVFVYESSKGNFVSGGTQASGKNTR
SMEALSVFHQFSVSGGWTLSVSDTSVDGYTGTLDAWDISFALAPCVPKFTWRNLSALATG
TPPSPRYQHAAIVYKRSIFVYGGRNGANGKELNDFYRLDYPSTTASGSIQWTQLVSLTTE
ATLSERRFYNGRVTLVTPYDLLAIGHGLRSPRRIAGVTHHFASLGQFVGRKSVTDPRKGW
RRVSISTVDEDSVIVASRYWSANAFVADDDTSNVGSRPIVYMFGGQDDTTLFDDFWQLDL
DFLAEEASAESIRGRRSAVCNWRLSNAMYQAQWSQSCGATAALITQSQAKECSLETLLLY
VWCEQQYQSISL
Download sequence
Identical sequences K3X1L9
PYU1_T011118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]