SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011279 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011279
Domain Number 1 Region: 93-213
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.28e-17
Family Ubiquitin thiolesterase protein OTUB2 (Otubain-2) 0.013
Further Details:      
 
Domain Number 2 Region: 3-79
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000138
Family Ubiquitin-related 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011279
Sequence length 296
Comment protein Name="PYU1_T011279" Note="Similar to CG4603: Ubiquitin thioesterase OTU1 (Drosophila melanogaster)" AED:0.11952861952862 QI:0|0|0|0.33|1|1|3|0|296
Sequence
MGMNFKVTFSNGTSIKLLGLADDITLDELRAELFAKTQIPPEEQHGYPPKPLVGEGTNTL
QLLGIRSGSVLVLKEAPAGSSSGPATPSTVFLRRVVPADNSCLFNAIGYALGKGKTGNAN
VMRQCIKDTILANPDMYSDVFLGRPVYEYCAWIQDEKSWGGEIEVSILSQYYKVEMVVFD
VTSMSRLCYGEDQGFSQRMFLLYDGVHYDLVVESPSKTAPESRDTALFPINDFSKVERAS
EVAVEAHQNHEYTDLNRFSIQCLVCRQGFTGQREAQVHAEESGHREFGEVRPSRQQ
Download sequence
Identical sequences K3X230
PYU1_T011279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]