SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011437 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011437
Domain Number 1 Region: 230-542
Classification Level Classification E-value
Superfamily RNI-like 3.14e-25
Family Cyclin A/CDK2-associated p19, Skp2 0.047
Further Details:      
 
Domain Number 2 Region: 471-707
Classification Level Classification E-value
Superfamily RNI-like 4.24e-24
Family Cyclin A/CDK2-associated p19, Skp2 0.015
Further Details:      
 
Domain Number 3 Region: 3021-3111
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 6.93e-18
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0071
Further Details:      
 
Domain Number 4 Region: 2928-3033
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 7.72e-17
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0071
Further Details:      
 
Domain Number 5 Region: 2152-2246
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000148
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 6 Region: 3879-3913
Classification Level Classification E-value
Superfamily WW domain 0.0000046
Family WW domain 0.0022
Further Details:      
 
Domain Number 7 Region: 673-771
Classification Level Classification E-value
Superfamily RNI-like 0.000029
Family 28-residue LRR 0.025
Further Details:      
 
Weak hits

Sequence:  PYU1_T011437
Domain Number - Region: 808-899
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000956
Family Motor proteins 0.018
Further Details:      
 
Domain Number - Region: 2841-2914
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0017
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011437
Sequence length 3914
Comment protein Name="PYU1_T011437" Note="Similar to RSPH10B: Radial spoke head 10 homolog B (Bos taurus)" AED:0.0412040664325857 QI:0|0.4|0.16|1|1|1|6|0|3914
Sequence
MAFGSDDDGHEIPVRHRKKRSRPQSHLQQVESMDDRRRVHFALRGSALDQFQSWIKNSDA
EPPPVRGAGAAKQIPDSELLMFKDSRIIQDAKTPPIFPADENNEIHKRVMQQLSPQQHLR
RPRSWELSSPPYKKSSIRRSMGTLLREQLNTAAEDGMRHTLPLLARPSQRQTVRKDKAVM
LQLLAECKAKAEGVVTSPVPPNQPGSSRNQRSRGGGNELFRNGSDPVMAIPDSVFFATNS
FSPLGKIDLSDWTCFCTDANPAIFSHIGSKLSSRCVELNLSGLTALTTPRGFQALLQNCG
KLKRLVLSECENIQTAGFCAIAQSCPLIESLDLSESESVTDNVLHCVLSSFQNLTRVKLN
GCQRITDAGVLLFSAKKHEIHALEGLYLDRCHLVSNVSLLPLLKAHGATLQVFSIRGCRR
VSDTVIKELFINQPKKLQELNISDCTSLTDACMEYLSTVPSYFGDRVATAYHHLVQIDVS
GCMAFTSLACCWIAASAPFLQRIKAARCTGFCDKAALALASLAHLEEIDFTGCSQILESG
MERMFLSDGHTKPGSSVTAKQRVVDSVVKKIKKLMMADCPNQGEPCVLAIINSCSKTLVE
LNLSNIAPLPAKTLIKLVKHCRTVTDLYVQRQPAVTRSVLAHLTSCNKHLRVLDLRHCVN
VDDLAIYPLLVMQSLEELYLSGCRSITNRGLQSLPVSLIYLDLQHCRSHEFSDEGCRTIA
NRLSKLEKLDISHCDGVTANGISEIIQKCEFLYHLNVFQCPNITSVQLNRLLHDLRMNKY
ALDLISDPEMAFQGISSDNVDAAVKARRREKLLAEETRRQRAASSIQIHFTSRSRLRRER
KLRDDCEWEEFCCAVDIQRVFRGYRCRKTYVFVRPQVTKAVVYIQYLWRKKLVERRVRKA
MGYWTNRVVLKMFLLWKQHHLEIRMENERQKAAFHAAKALNFWGDKTLGRVFCSWRDCVR
NRTIRAKKAIGFWKCQSMPRVLEAWRMYKDNEKLRRLRLTHVFLNAVDLEAHNSSIQLDK
SKRANAVVKRLIWRLWREFVVDQKRFLLKATLSIVCGSLSAWAFRQWQQNALRKKQGREK
TRKMLLKIFHREKTSVWNTWLEFVHHRKANKRALLRFSNKIQVKCWFKWRQFHDKVQKLK
RVSGRIAARLKLMNAARAVTTWYEFTQEQLDTKQHMRRALTFFSNGTMVRVFSAWTGHTE
YMKVFRARTKARMENENLAFAITSWITFTRLRRELHVTVTKLQAFWRGCTTRRRIEDEYL
YRIWATVLIQTAWRGRLGHIIMRAATRKARLREYLRAERERDAMDVEEASMRKFNYDIEM
IILLQRQWRGVAARTLFVEIRRARYILKKQQEAEVQEVVRAEARKRQLDRLQHEKRRQLA
AIEIQRHIRGYLGRKWYRSQQEFLHEQRAASRVQAVYRGRMSRRRTSALRRSYITRMEIL
ARRAVEGKVLRALGTKTRSTQRGLRSFLDFFGLDPATFLTDIRTVFKEVREDFQTMKKFF
DVIKTKVHANAEKNAAAAAALPAPDASSTTATDKALRLLQKTDAAKRFLSDFERIVDTTT
AEKEKKDQMIMPGMAVRIVLRGHARCGETAFVLSVKEEIAQVKMDVDGYLEFFPLMLPAT
KVEPKKYVLHRVPELAFTAAYTSTMANGKISELWRQQLEAYATSIAEESKRYCAARVIQC
AARVYLSRMRYQLELEAQGVNAARRQKALLRVLKTFHGANTRVANILVQLRFVHALNLPP
NLPDEPLEIQKVLNRFQRWLSRRAEIQHAFLRLVPEEFKGNGQLHGQMTPVSYTSVFDKL
LHYPIQWLKRATCVPVARQLEKRGLAELAAFISGSEFVKTFEEMHTDAREHCFPQLQSCS
FCASEGWALVHGVFLKRKVAIEYPSLQNSSKRKKYATKLVPHGWGVAHFLAGQVGKSRNW
LARNSIEAQFKSLQIVKAMKQKEREERLESQILARQGTMNTLRSAEGARGFAKRHAELSV
LEENTKAFYQRYVDEIALREKEEAKIFEEEQRVNELTATEKLELERQGIHLNALQQQVPE
MVVEIEMVRSSKSALEFLAPGCVVEVEYDDEVWYQCQIVNIDPYDTYMAEIVYVEDQRKE
KIKLLEASSMDEKLFQRRGGATMKTKTVAEITAAAAAELEAQEVPFRKWRAGNAVDISWE
PPFDNGTPITQYVLEWKDENNEAITGKKEVTGHSANGNDERTPRTVNGHVSTKTTLWPIP
EENVSTIRVRIAATNKKGVGLASVYSSLPEELTEVSYRTAIPLTRPPEDTTHLETREMSD
MEIEDKASLEHRRRLTCTICQRNLPTEAQVHEHVARAHSVPLLCPFKSCRQVCASEKTLR
YHIWRCTIPKPTNEEFQSELFMEIFNISRQYCMRKPKRHVLPAQSALHTEDGTTGKEVYL
ENKYQDARRAWFEKGKELHEKNLEKDATARRRERENRYDPPRELYGLDFASPELNVARRN
VVLNTIQILQTDLDAYIVETNTQMDQLKHEEKELLDYIALKVKRMKTSDEEWQKQSLQRE
KKKAQKSLDQVQEKISILTVTLTQRIEEMTTEIQRLTTIEKAFVPFTHQVIKMMRLGTLI
WQTHAKSNDIFHTHRVILDHFQDELRKLMLRAHHEVEGLEAWDAMIEARRKQLQTLKDEL
RKLQLMHVAEIQSYRQKRDEGDEAFALRKLRGQQIRIITRQERAAQQLLEKQTRLQAAAN
ALEAQQSPEPASLELTTAIKSLHIVNHDLELHEKFIKGKSEDVEYLKEEPSKAGTSDHMM
KGKLLDTVAEEVATMLPQKPATGQATGEQPSLPFVGVADGSGEATTVSPSLAESPRKLVK
KTKKHSRMKLQELPHTYTRLECDFQDGFIRGHVRIEYNDGSVYEGPWVEDVSYNKPSDME
PMKTRFSPNHWGKFTSRDGTIWEGEDVDNFFSPFTAMGENFHVTTRENNKYIGAVRAGKY
HGFGTLHINFVFSKGEYVGEWCEGKRHGYGIERFDVGEIYEGYWEMDVYHGEGEIVYDDS
SRYEGSFRYGKWHGEGVRTLENGDRIVGHFHEGLLNGPGIMEFADKRHYHGSFKNTRRHG
LGVLTFPNGERYEGSFENDLPHGEGKYITKSAPGENGNREPLVRMGKWVNGERTAWLSKP
SSELATSTFIQYFAVQQNLTGEMEIDLVLPKFKTPYAVMVASMLPNLPEGVNADDAFVKV
IMKMLAKTQNIMVGTDILDKTIAEHTQVKYELDNEVEALETLRNEVDAIERTYRAQQRTV
NEQQQERDTMAAKELEMQVKVETFWKQKDHAQLENNYKRAVEGLHDVDIMDWFKLRTAKL
DAVYLSLLDAFAVLLHFTDNAYLGGKMYTPTKEDLMQLLSSSNENVFLGDKEALIHKYDV
KALYVLPLFDVYSFGEGTRNAMLNNLTHVIHHPRLRPNNFRLNQISPAATAVCMWVRAAF
FYAKKAVEIYPVMKRVLDQLIIVARLRESLASENVKLEAERQRVEIARQQLIDQAVRVEE
LRRHEQELQKVIEGIDELDRGEHERIEKQHVKRPQTYRPPSAGINAARLGGIEDKGEQGP
LQIAAPQVNHRQVFEEDHDADAKAKHTQRVQKEQVLQQILGTPALAEEFRILKKEVAKVI
DRCEGSVPLADFPIQFERIMLKPLDPRTFGVKKLTTLLALMSDTCAVVVPQKEDEVETVQ
FPVAIDDDDDDDEDEGSGGDGSKGPGGMLPPRLACCCRVCPGVSYATRSELAFHEKTKWH
FWNVSAKREGKKPRTWTVAATFWSEAYDSVDGQICYFNKLTGEIVKTSEPPREMQANDVL
LELLDDEGEAATTTSTGTTEPAGVYPLDGFLGSDDGVDAAGAGMDASQSASLQQHPWSFA
VNTGGDEWMHASTTMQPSSDQNQISNALENAVDHSSMESEVMAADSYWEEVADEAGNVYF
YNRLTDQASWTRPM
Download sequence
Identical sequences K3X2I8
PYU1_T011437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]