SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011513 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011513
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily SNARE-like 1.1e-30
Family Synatpobrevin N-terminal domain 0.000024
Further Details:      
 
Domain Number 2 Region: 136-203
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000000046
Family SNARE fusion complex 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011513
Sequence length 223
Comment protein Name="PYU1_T011513" Note="Similar to SEC22B: Vesicle-trafficking protein SEC22b (Homo sapiens)" AED:0.140379207060545 QI:0|0.4|0.16|0.5|1|1|6|0|223
Sequence
MAIITFVARVSDGMLLVASMESIGDANGNLDTYKQQGKQIMKKLDQRSPTKCSIESGSYT
FHYLIQEGVCYLTLSDRSFPKRLAFLYLEEIHAGFVEELERDHGTNWRDVVTTVARPYAF
IKFDKFIQKKRKEYTDPNSSQNMHRLNDDLADIHNIMRKNIQEVLNRGERVEHVSRISSN
LADRSKDLKWGAKKLRMQAIYRQYAPIAAVTLFVLLVIYMKFF
Download sequence
Identical sequences K3X2R4
PYU1_T011513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]