SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011765 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011765
Domain Number 1 Region: 91-183
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.96e-25
Family Cold shock DNA-binding domain-like 0.0000441
Further Details:      
 
Domain Number 2 Region: 185-304
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.31e-24
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 3 Region: 40-90
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.0000000017
Family ECR1 N-terminal domain-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011765
Sequence length 308
Comment protein Name="PYU1_T011765" Note="Similar to EXOSC2: Exosome complex exonuclease RRP4 (Homo sapiens)" AED:0.0361380798274002 QI:0|-1|0|1|-1|1|1|0|308
Sequence
MQIHVRRQAGADGLDVDGDVAMDLLEHKEQQLQDEQQIVVVTPGQVISTETGAFLRGHGT
YLDHQTNELIASVTGVVEKVNQLITVRPLVSRYIGEVGDIVVGRITEVANKRWKVDVNGQ
QDASLMLSSVTLPGGAQRRRTYEDQLQMRNFFVENDLISAEIQEVRYDGSLSLHTRSLRY
GKLENGQFVQVAPHLVKRMKQHMVTLPGIGVDLILGTNGYLWLSRSFTALNGGDDSSMDD
LSTGNMETRVEILMEKRQQHANTKMSVDDRKKIARVYRALLHLNEQFRLITPESIMAVYE
ALLDQEDA
Download sequence
Identical sequences K3X3G6
PYU1_T011765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]