SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T011890 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T011890
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.3e-34
Family Ubiquitin-related 0.0000249
Further Details:      
 
Domain Number 2 Region: 100-154
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 8.97e-20
Family Ribosomal protein S27a 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T011890
Sequence length 156
Comment protein Name="PYU1_T011890" Note="Similar to Ubiquitin (Phytophthora infestans)" AED:0.305732484076433 QI:0|0|0|0.5|1|1|2|0|156
Sequence
MQIFVKTLTGKTITLDVEPSDSIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGGKKRKKKQYSKPKKIKHKHRKVKLAVLKFYKVDDNGQIKRLKKE
CPSPGCGGGVFMATHFDRHYCGKCHVTYQFQNEDSA
Download sequence
Identical sequences K3X3U1
PYU1_T011890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]