SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012228 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012228
Domain Number 1 Region: 27-138
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 4.05e-28
Family Calcium ATPase, transmembrane domain M 0.0026
Further Details:      
 
Domain Number 2 Region: 138-166
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.0000863
Family Calcium ATPase, transduction domain A 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012228
Sequence length 168
Comment protein Name="PYU1_T012228" Note="Similar to PMA1: Plasma membrane ATPase (Dunaliella bioculata)" AED:0.0117647058823529 QI:5|-1|0|1|-1|1|1|1|168
Sequence
MAGGGNSYMSMATPNDQKNYTNEVGQIQWGSIPLNAALDKLKTSREGLTNDEAQKRIAEY
GPNKLPEEKVNKLMVFLSFMWNPLSWAMEVAAILSIVLLDYSDFGLILFLLLLNAIIGYL
EEIQAGDAVSALMGQLAPEAKVFRNGEIVNISADQLVPGDVIRVRWAM
Download sequence
Identical sequences K3X4S9
PYU1_T012228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]