SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012615 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012615
Domain Number 1 Region: 46-330
Classification Level Classification E-value
Superfamily DNase I-like 6.02e-41
Family Sphingomyelin phosphodiesterase-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012615
Sequence length 485
Comment protein Name="PYU1_T012615" Note="Similar to SMPD2: Sphingomyelin phosphodiesterase 2 (Homo sapiens)" AED:0.0402144493320438 QI:0|1|0|1|1|1|3|0|485
Sequence
MGVVEVVNRIRRRVTLEMLDLEPIEEPPAPRADWPQWEGEADGAKDVKIRVLSLNAWGLP
VAPKVTERAIEIANAIEGEYEIVVLQEIWHRRERNLIISRAEQAGFHYYHYFNPAIGFPV
PLGHDSFGTGLLVLSKFPIVGVLYHSFALSGRPYALHEADFVANKGAGLLRVHTPAGQID
LYVTHLIANYNALGAPGPGDCYLPHRTGQSYELARFIAATSRNDLMIVCGDFNSPSDSIE
LRIPKEIVQLRDAFTDTNSEDGLTFATEDNKYSFGDHPMRMDYVLYKIQKQQKGQPAWQL
VSSDVFKGFFKDAGGEKTPLSDHFGVKAEFVFGPKRPHSCEQLSSDDGESSMDVRSCLTT
TCTHCDEVEGTKYLANSFPHSVKVLQEVQQVILEGRARAIMRRSGHLRRAGFSFFVVFAL
VVSRWFLLVEGNWSLLVMALLAVQGLVEYILAFFFVTLECSTFTELANQVRLHLNAEQSN
AVVLL
Download sequence
Identical sequences K3X5W6
PYU1_T012615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]