SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012639 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012639
Domain Number 1 Region: 82-173
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 1.44e-26
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.00045
Further Details:      
 
Domain Number 2 Region: 162-269
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.91e-20
Family UBX domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012639
Sequence length 272
Comment protein Name="PYU1_T012639" Note="Similar to At4g15410: UBA and UBX domain-containing protein At4g15410 (Arabidopsis thaliana)" AED:0.211771844660194 QI:0|0.66|0.25|1|1|1|4|5|272
Sequence
MANIVSFSSMNRRNGDDGNDDDDDARRQPQSYYAGGASQRGGGSGLSVIGPDDGSGGDNI
ANIIERARQEALRGSDGSSGGATDGQPPRHVITFYRDGFTVNDGPYRARTDPENRPFLEA
IERGVVPRELEGDNRSEQVEINLVDKRQEEYQAPPAPAYVAFSGQGQTMGSSTVAADAVI
QGATVPAERPVIDDKKPKTTLQIRLHNGTRLRETLNLDHTLRDLHAIIQLNDAGAASYTL
LAGFPPRPISVDLDQTIESAGLKGASVTQKLV
Download sequence
Identical sequences K3X5Z0
PYU1_T012639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]