SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012641 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012641
Domain Number 1 Region: 238-534
Classification Level Classification E-value
Superfamily DNase I-like 1.01e-37
Family Sphingomyelin phosphodiesterase-like 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012641
Sequence length 534
Comment protein Name="PYU1_T012641" Note="Protein of unknown function" AED:0.00560747663551409 QI:0|-1|0|1|-1|1|1|0|534
Sequence
MRYAVAVAVAVFILLVSALFVDARPHDEPLQRWDFWPPLPDSPYFTGRYLTSRPGGIHLT
KQRFDAINLFALGDEDTPASQNVLLYGSVLLDPIFPASLGTDPGVQAAFTSAVVAIKKRG
DVHVSPDVKVTRAIVLPLKATGDNGESEMVVLHEYRDLTRRLREFKSHITFGFNYLLTLE
DKKFNLVHNVMVGLDREGVHNLFQHTYFPLDKALATSSCATPANGQSQSCEPDVASPRIL
SYNVWNTNPSADVYGYEKRWTQYAKRMDHLVRFVHEANADIIGFQEVRYDGVFGGEGNHA
QVQHLANRLPGYQYVYQPAMSYLNAHSPYERIEEGPAVFSKHPIVQTGYLLLSRDPNDPN
DSHQRLCLHAVIDVPGWGFIDVYVTHLSLSERSREKTMVEIWKYMRAGKGKTQVLLGDLN
AEPQSQGLQFLRGEAELLGETTDLKDAYLEKHVEPEPRSEDPVDRHDRFTFPSDNPVKRI
DFVLYRGKGKVHDFKTIGQAPTDDTKGFPFDVGMLNRRSPVYASDHRGVVVEFS
Download sequence
Identical sequences K3X5Z2
PYU1_T012641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]