SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012694 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012694
Domain Number 1 Region: 290-515,553-624
Classification Level Classification E-value
Superfamily DNase I-like 4.97e-34
Family DNase I-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012694
Sequence length 628
Comment protein Name="PYU1_T012694" Note="Similar to PDE12: 2',5'-phosphodiesterase 12 (Homo sapiens)" AED:0.358804528062532 QI:0|-1|0|1|-1|1|1|0|628
Sequence
MADGGDEDCGMRVDAEGADNTMRQQQHVAHVRLVDGDDHLRLQLRILNDRKTLFRPTTEK
LDKIRYRLQILATNAAAEADATCSNSSNRKASVGQSLSRKAKSAAAKKKKKKTAGRPAEP
QHPTMKVKVRFFDECGQEFLSRSLVIGDVLMHTARIEIGDVQYVVLRNQPLVLQLNVVDP
VLAGIPIVPFPETEFCHPDECRWTWFRINEQQEAKVQCCTARRYIPTKADIGSRFRIECH
APSMHSVYAEDSKTEVVTSAVIEGPHREVFRKRQLLGETRAQNAHHGDAFRVMSYNILFD
GYTTTDHAQQNLFPYAKPSVMNEMYRMQLVFQEIEECNADIICLQEMGEAAYNSFFVPMM
KPVGYHTFYSGKTGSTHEGCAVFVRNDCFDVLQEHTIDLSMTVKHSPDPAIKALLAEFPE
IAKGFDKIPSVAQLLLLRSRRDPTKHLIVSNTHLFYREDADLIRLLQAVALVREVSKIRV
DLGGHVALVLCGDFNAFPDTVTVRFLLDARADSTHRHWQEAPFFKWNRTLAKAGNENSKE
HPKNHRVRHGCFEHQLQLVSGCGIPEFTNFAGTFVGTLDYILVGAECLDAKQVFPFFTTE
EVSEEVALPSSEFPSDHVSLICDLVWKA
Download sequence
Identical sequences K3X645
PYU1_T012694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]