SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012849 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012849
Domain Number 1 Region: 797-923,951-1010,1426-1606
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.39e-85
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000919
Further Details:      
 
Domain Number 2 Region: 409-524
Classification Level Classification E-value
Superfamily DUSP-like 5.89e-20
Family DUSP, domain in ubiquitin-specific proteases 0.0027
Further Details:      
 
Weak hits

Sequence:  PYU1_T012849
Domain Number - Region: 263-312
Classification Level Classification E-value
Superfamily EF-hand 0.000259
Family Calmodulin-like 0.047
Further Details:      
 
Domain Number - Region: 1141-1228
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0723
Family Chromo barrel domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012849
Sequence length 1619
Comment protein Name="PYU1_T012849" Note="Similar to Usp4: Ubiquitin carboxyl-terminal hydrolase 4 (Mus musculus)" AED:0.356172839506173 QI:0|-1|0|1|-1|1|1|0|1619
Sequence
MTAAAAASSSGGRKRNAVRRFFSLSKYRRRFSSPSAHAVRGSSSSIASFARVSSSSAALA
SFAFASNDLHDHVDDGDAGGAPVTATTHFSPYLCFPQQRDNSGALSNSEVSREYRRRRRQ
ATLSTCARREYTRRCIDTWTSAELYVLRELVDRAMHPRKYPRRHPDEHFGFQLQDQQQRR
KSSTLQRVSLVVESLLAHSADARSSHGDDDDENAAHDPRASLSYSHARRLHYRDHIDQRL
QLRKRKHLIQLFPMLECIHHGVQRQLFCVLDRNRSGRIEFTELCEMLTYCHVDSLRQNID
FVFLWFHKARHGGRVGITAQGVHLLVGTVKELVATHETLASMLKMPQYDYLDALPDTILQ
GQQVVSLDQFRERIAAHDDVIRVLLTPFNIVRTAMNEMRLWHAYQASSEWHHEGNTAYVL
SKSWWNQWIEYILYSTDFSGDVLSSFSAQTFGSSTQTQHHHEVAHERFRCRPGPVDNRDI
CADPQAGTLLPNLILNVHFVVVPPRIWQALMQLYGGGPSFPRQLVVPLSSSYLQERETHP
EPRKSSIDSAMQAIGSSELYVDLYPISLPIRLIKRDAARVTMIFARRFLLNRDTTLKEIV
HRLGLQLGENAAEITFWVRRQKLDPWKRIEYSLDAPRSSLRDLRFKSSFEVLVDFQPLET
GDHSKEPRYSRHRRSSNASTSSVAQSMIKQKPFSIGGFRSMGNDFVCTEPGLSRFLGNVP
IKANMSDSTTYSPDRPSSDNYTRSTKQSSESRDASLSGILSPNAVFSDIEAQLVARQSGF
SLASSRRLTMFPGIRATGLLNLGNTCFMNCALQCLGHSPIFREYFLSQRHFNDINKKNVL
GTRGKIATVFTRLLESMWRQRDTSFYVPVMFRDEFTKFRRNFQETRQHDAHEFIVALLDS
LHEDLNHGRSFGDEETSSCFPYFGNRSRLSVAEDEVAMDPPSSSSTVCLSDAAIGNQSWQ
NHTRVNASVVVDLFHGQTRSETICATCGDRKVAFDPTLFFSLPIPEAKYLRLEVNVVLQV
RTNRANDNSTGSDSVGLAIRPVIRRGFWIKRGSNTGSLSDQVAAAYNLQGNRILLVEVRK
NRIKRVIEGDEQIESVAHVRELYAYERAWTLSEIPAVPPIMTKCDMNFVKAGPLNNFGDL
QLGSRVDAIGFHGEWHAGSVVDLIDEPIDKKTGSDSVVVRVDTGAHHGDQPSYQRICVHF
DGFSSKWNKWFVETDWLEQRIAPLEMHRKSVREVFEVQVIHRMVVSPSSSPPSFLATRRG
RAHSIDEDEVSSSNTNNSRAFQIFGVPLFVTIASDKTSRDLHHAILLQASRFIPQYEVNE
FACGDEAHTSVDKCAAVQLPALPFTTRVTNLEDVSGTLGDELPFDNSGILQHFSAQSVIV
LDWSKDSYTDNLERVAPEDDMHPPGGMEEGASAVDCSAQTPKRDTIITLDKCMDAFLKNE
SISLEDHWICERCGVAREGLRKSDLWRLPDLVMVQLKRFQYFENQHRQKVRAFVDFPIDG
LDFSKWMGGSSTTTTATTNTSAASSPDYVYDLYAVVNHVGGLTRGHYTATCRYDRAFEES
ARVFAASRDAEVPLNDLWYRFDDEKAVEIAAGDVVTDAAYVLFYKRRTLSPHNILEYTL
Download sequence
Identical sequences K3X6K0
PYU1_T012849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]