SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012862 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012862
Domain Number 1 Region: 174-439
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.07e-24
Family Ankyrin repeat 0.0014
Further Details:      
 
Domain Number 2 Region: 97-187
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000209
Family Pseudo ankyrin repeat 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012862
Sequence length 492
Comment protein Name="PYU1_T012862" Note="Similar to MIMI_L59: Putative ankyrin repeat protein L59 (Acanthamoeba polyphaga mimivirus)" AED:0.108519269776876 QI:0|-1|0|1|-1|1|1|0|492
Sequence
MSTMSTTNDAREPGAAIQVLVDPTLLRCITECATGWPWLVQRFYEQTMPAYAAGRTWRDR
SYIKPGIVGLLPHLAIAENDLRVLKMLYAMHKFAYYRDHHPQLSFVRVMQCAAFYGRVEV
LQWLHERLPRHPEWDLGTNMMKDAIRLRDAHLMDWVHAHFPHMTRKINANLQAKSGSLEV
IKWCHKHKLKFTKLAMAQAARFGHLEIIRFLHENRTEGCDNYAMDNAARSGNLEIIRFLH
ENRPDSASTNAMDCAAEKRHFDVVQYLHKNNPVQQCTTIAMDHAAAAGHLDIVRMLHEER
QEGCTTNAIDEAAWGGHLDVIQFLHEHRTEGCTPQAMEWAAFHGHLEVVRFLHENRSELV
TVKVMDNAAGQGHLDIVQFLHENRSEGCTKRALHGAFVGGHDKVVKYLCVNRPELCYDDL
LNDAAAHGSDAVLRVVIEHSSVGCLLEARERAATKGADRVDLLSEYVNEDAELCSRARHA
DPARRPCQRRRF
Download sequence
Identical sequences K3X6L3
PYU1_T012862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]