SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012893 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012893
Domain Number 1 Region: 1-80
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00000000000113
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012893
Sequence length 105
Comment protein Name="PYU1_T012893" Note="Similar to metG: Methionyl-tRNA synthetase (Mycobacterium bovis)" AED:0.174528301886792 QI:1|1|0|1|1|1|2|2|105
Sequence
YFSNNEPWILAKQLRNSRDPSSAEHQALQKRLDTVLYLTIDAVRMSAILLQPVVPESTTK
ILDYLAVPPATRSFEYATMMDASSSNGGTRIDNARSFVAFPKLLK
Download sequence
Identical sequences K3X6P4
PYU1_T012893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]