SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T012935 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012935
Domain Number 1 Region: 12-127
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.31e-28
Family Canonical RBD 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012935
Sequence length 210
Comment protein Name="PYU1_T012935" Note="Similar to SFRS2B: Splicing factor, arginine/serine-rich 2B (Homo sapiens)" AED:0.223707098588615 QI:0|0|0|0.25|1|1|4|0|210
Sequence
MDVDTTDDKPHANRSRSPSSKGTKSKVADGSMSPSKTYSLRVDNLTRNVNADHLSEIFGK
FGAVVRVNLVRERGSKVPKGFAFVEFKSHEDAESAQDHMHDGWLDGKKVRVRFATEDDNR
RSRSVEQRRDSNGNRDDGRKQSANGRRGGRDNNPRKRSFSPPRGRRSSFSPARNRSPGAR
SRQRAALRSVVAMAVGVAADRLSELEAAVQ
Download sequence
Identical sequences K3X6T6
PYU1_T012935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]