SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013005 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013005
Domain Number 1 Region: 735-930
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 3.77e-36
Family FucT-like 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013005
Sequence length 962
Comment protein Name="PYU1_T013005" Note="distantly related to glycosyltransferases" AED:0.227414330218069 QI:0|-1|0|1|-1|1|1|0|962
Sequence
MLLLTLVSALLLLHDQDSTRIVGASVAPSPSGRLDAPSRHHVELSQHSEPDPSAYGPNTS
SPRTRWSRIRYPLDGSVNVNPVAFRCEFTSDNFADFQRQTASALLCVEVDHKWIQCQPVG
QAPSEFPELPAGDHTAVAFLTAREQGARSNESEAITFTILTPTEYERYVEGRKGQEREAY
ALPEEQDLLTWAANHNSIEEAHVHWNGDMMRDARVSFQQSLPDPLILLIGIKTSVISGFA
QRQAIRSTWASASAFPKHAKLFFVGCQPVLSNSDPRSEETADNSNAELLRAIEKEKHTYG
DLLTNELACQDSYFALVDKVKAFMHFAVTQFPTAQYVMIADDDIYLRTDQLVRVLQVHGP
RSRVYVGQVWAKQFMTPMYSMRSPTHKNYLPEEQYPMSELPPFAFGPHYFISMDCAAFIA
DNRDELRGLAALDDVSVALWLLALQVHPEHIEHFQNLRDTPCTEGLISLADLSPSAIRII
HANLHADAPFCRGVDLTTWRKVERPFRAAETKRKFTVTTKTAMHTNGLQVTTTFTIDSAG
SIEFAYSPSRESVEQHAAAICEHLQPSLVYKFDCSSDVTPKVHSSMAASLEHTMENRETN
PAFLGLWIHNLQLFRADATVPAPAAKIVVYSRNAMFSKTLLECLFASVYTLNPVFVVDET
TFHQHPEYQGVSPDVVVFSILDGSCWSGWDPRCRQAAADYVQLYGSTSLLVMLSGEAWDV
DGLDDSVLLISTVAHVPRRKHVYIPMASLSFGERLIQSPLLLLANTDSGPSSLLEEPQSQ
LTHRKFCAYMYARCDRPQREYMFDLLSTMEPVDALGACQGSSRAPNEKRWTGRSSIWYND
DAVRLYSQYKFVIAFENGQRPGYVTEKLVNAFLAGSVPIYFGHSESVAQVFNPESFIDCG
RFAMLRECAAFVIEVHRSPAKYTRMARAPVIANVSLFHELFSWHPDIPSSHLSDRIREFL
LK
Download sequence
Identical sequences K3X706
PYU1_T013005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]