SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013484 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013484
Domain Number 1 Region: 28-76
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000342
Family PARP-type zinc finger 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013484
Sequence length 127
Comment protein Name="PYU1_T013484" Note="Protein of unknown function" AED:0.09375 QI:0|-1|0|1|-1|1|1|0|127
Sequence
MATEMEMPPPPPPRARGRSAWSRCDEAVARIAPTSTTTCQVCSQSIAQGEWQLGVMFIHV
EGFMLMEWYHLQCSFCIPGGGLQDVLETVQSEMTSAQKLQFQAAYEKLVTSGGNEGPLAM
ASATMVS
Download sequence
Identical sequences K3X8D5
PYU1_T013484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]