SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T013928 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T013928
Domain Number 1 Region: 261-413
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.8e-27
Family DnaQ-like 3'-5' exonuclease 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T013928
Sequence length 571
Comment protein Name="PYU1_T013928" Note="Similar to SDN5: Small RNA degrading nuclease 5 (Arabidopsis thaliana)" AED:0.201714844709703 QI:0|0.33|0|0.5|1|1|4|0|571
Sequence
MPFFTTPATIASSSSGGDGTSIQNTKKRQADAVDGSLLRGSLEDLVRAKQQQTVPLADIR
DVVMDHVLETLETDLKYTVFLICEDVVDLVLGDKDAQTTQTKKDGEAVVSNDGAVAAAAT
VAASAENPEVNTSSSGAMPFLDGTDSNWYRFHSQLSEGDSIPRCDATLLRMPVSKRDMEK
EKKAAKKSVKMKIKKFKKITGENAKPSAEFYVLSPQELKVHVSSIPFDSPKDDSNSNNAS
EFLTTQPLPDGDARSQEQLLLALDCEMCKTTKGVELARLTLVDANEKVLIDEYVRPANPI
VDYCTQYSGITFDIMEDTTNRLKDAQELFLKHVPAEAILVGHSIENDLQALKILHHRIID
TTALYPHPKGPPFRSALRFLASTYLNKTIQSGSDGHCSVEDAIATLQLVKMKIKHGPTFP
SIEQEYKQKKVINELYRVKKTALIVDSLRACRSLSGGVAGAIPCEDNDKIAHTVVHQLTT
GFPPNFTWARMRGTTRQEIACHVTTIQSQLPKHSCFVVVLARECSELRELHKLRTTRADP
RCSLMWDKTMQAKLDAVARDAQHGLVHIYLK
Download sequence
Identical sequences K3X9M9
PYU1_T013928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]