SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T014421 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T014421
Domain Number 1 Region: 106-433
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.24e-90
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T014421
Sequence length 761
Comment protein Name="PYU1_T014421" Note="Similar to USP36: Ubiquitin carboxyl-terminal hydrolase 36 (Homo sapiens)" AED:0.0156779661016949 QI:0|-1|0|1|-1|1|1|0|761
Sequence
MMVMAPQSSVALAAPGGAGAASNHVTTHLPAQGAVFNAKSAVALVNERRIEFVRARNVRV
IGKIDEATGKVLGPSSSSTTGQKKRVLVESEDIERLLAWKHSKKIGPGFANLGNTCYLNS
VLQCLTYTPSFVQYLLEKDVFVSFAGGSSSGNNKMLSNGNKGSNGFCGVRVMSRLLQSIH
SNGGSNGRVLQPKEFVMNIRHVSKSFRIGRQEDSHEFFRLLLDSMQRSCLRKANIKQENH
PAAPTTLVNRIFAGKLKNSLKCAKCKYVSERFDDFLDLSLEINNGIKSIKGALKHFTAVE
TLDDSNAWKCSSCKQLNRAEKGMTIETCPNVLVIQLKRFDIMFGKIKKHIEFPTSLDLAS
GMSKSSDDRKRGRTKYELHAVLVHAGYSTDCGHYYAFVKGPSGQWYEMNDESVRWVSLDT
VLQQKAYMLFYSRVLPLSERPKPKEKAKDEVAAKDSAVKAQAGEEIPVKVTESNGVALKT
APKLTKELDMNGFLASLKTNITSVNATDDTIPAVREDADIQRAPSKKKNVVVTFNVTKRR
ALSSSPSAPEGTSPIVLLPPKTKRSLTPAFSGRVGRLYKFGAAVWRPYSPLDMVTSEVSE
VVKETSEPQQTQSKPSYESSPKLIAAAAAPPAADPKPAKLTKIHFDPRQLKNIGVKSAAL
FGKSVDKWGETNGWEDEASTEQGENATTDLDRELAAKHDRIMSKLKNEDWKHRNAGRQDY
WDETLDAGKIKKVKKRKEFVPNQGLSNKFQTKLQHKKQRHH
Download sequence
Identical sequences K3XB22
PYU1_T014421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]