SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T014532 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T014532
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000111
Family Ubiquitin-related 0.0049
Further Details:      
 
Domain Number 2 Region: 126-163
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000833
Family HkH motif-containing C2H2 finger 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T014532
Sequence length 321
Comment protein Name="PYU1_T014532" Note="Similar to SF3A2: Splicing factor 3A subunit 2 (Bos taurus)" AED:0.133540372670807 QI:0|-1|0|1|-1|1|1|0|321
Sequence
MDVFVRAPNNLLHTIRCAGQQSVLEFKHAVQDATRVPLEAMKLRFATSLLADDGAMLSDY
KIQHGASISIHLSLRGGIDFQNRAGSKPGAGGVASESQSNIDRRERLRKLALETVDLAKD
PYFMKNHLGSYECKLCLTLHNNEGNYLAHTQGKRHQTNLARRAAKEASDAAHSASAANLL
AAKAAAAAAAARPRALKIGLPGYKVTKQRDPDTGARILLFQIAYPDHDPKLQPRHRFMSA
FEQKIEAPDKNFQYLLFACEPYETVAFKIPNLEIDKSEGKFFSNWDKNGKTFTLQLYFAV
DSDEKKDQPAPPPPRPQLRYL
Download sequence
Identical sequences K3XBD3
PYU1_T014532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]