SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T014672 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T014672
Domain Number 1 Region: 228-264,320-383,413-641
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.3e-58
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T014672
Sequence length 718
Comment protein Name="PYU1_T014672" Note="Similar to ubp3: Probable ubiquitin carboxyl-terminal hydrolase 3 (Schizosaccharomyces pombe)" AED:0.321279554937413 QI:0|0|0|0.2|1|1|5|0|718
Sequence
MAKATTNAWPPRGANAPAHSKQQQQRSTSAVNGGAWGKSHHNKSHAHASSASASAAPSSK
PNGSAGDVWGVKKSSSVAPAPAVPSVEAKQPANAAPAAAKPPPVSAWGVNKPASVTAAAP
SSAAPITFGDFTVEETFKVLQEVELVPQEGESEKAKQAPPPPPMTKSWAAALGVVKEEVP
APPPPAWGGVAAASGPVKATRDHPVPFEHALQEALRSLDVTAPGQEMKKRGLVNQGNTCF
QNVILQSLLVCPPFLNILVDISSAVAPTDQLLAAAPSSFKVWRHIIAFVREFEEPVLGKL
NGGEVSGMGNSSNSKVPKSIKISGYFMDVLSEFQKMRGEQEDALEFLEFFLEYLHSEYER
SGLTLPPCCEAQTKQSTSTKTFDEEASGWEPGLAGFVDDEWAEVGKKGKSSVLRQNPVDT
IRSPINWLFKGALRSELKQSGKKQSSITIEPFHCLHLNLDRQDADQTPTFVPGTNGVARL
PVPSSYTIENMIRKAFEVEVIEDANRNPTMKRFTTMESLPVVLTLNIKRFTYHPELGPVK
LPQFVKYPTRFAFPVDVMSPTCRAENASSNSPGSSTRFQTPPVYELFAVVSHHGKFVVGG
HYTCVCRDNKDQWFRFDDEHVASISEATALAENAYLLFYMRTNAPMIPSDPEAENVETTT
PGTATKKTGGAPWGQQQKPGAGGRGPIPGMSTAPGTKKQQPGMKKDQTQQRKPTKKSS
Download sequence
Identical sequences K3XBS3
PYU1_T014672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]