SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T014979 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T014979
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily Tautomerase/MIF 4.28e-27
Family MIF-related 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T014979
Sequence length 120
Comment protein Name="PYU1_T014979" Note="Similar to MIF: Macrophage migration inhibitory factor (Bos taurus)" AED:0.0381679389312977 QI:0|1|0|1|1|1|2|0|120
Sequence
MPSVHVFSNVSKASVVTASALRALSKSLSVALDSPEPSVLVQLSLDQPMLFAGSDAPCAF
IHIRSIGKIDAEHNPKTAQALTATVTDVLGVPAERVFMNLSEVAASNWGAKGTTVNNLKK
Download sequence
Identical sequences K3XCN0
PYU1_T014979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]