SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T015311 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T015311
Domain Number 1 Region: 8-87
Classification Level Classification E-value
Superfamily DNase I-like 0.0000756
Family DNase I-like 0.049
Further Details:      
 
Weak hits

Sequence:  PYU1_T015311
Domain Number - Region: 109-196
Classification Level Classification E-value
Superfamily t-snare proteins 0.00824
Family t-snare proteins 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T015311
Sequence length 326
Comment protein Name="PYU1_T015311" Note="Protein of unknown function" AED:0.0219476807814738 QI:1|-1|0|1|-1|1|1|2|326
Sequence
LDSSSPDLHYDPGRSSCLEWLAKLGVVDAWRIHYDTKRVFTGPLPRKNRLDYILLSEDFY
TRFYDDSKYFLPKHAGDHLAHSVSFRSGSQLHGRGYWKFPHYLLEYPLVVSAIEKEAEMV
LDKLRTSTYPGKIWEKWKASIKTQLQDVQKKLRQQDSQAVEVARTSLDQAAARYRASSDD
SSRELFDEAMRNYKETVTRTSQYNQDTAFDFQAANSEKSTKHFFRPLDTSLRKVSIEEVM
TPNGSVSSNPHEISLRFLEHWGSEMGDPDSPAGRAPPPNEAMQRKLLDSIVCFVAEIDRA
VLNAPVTASDLASAIRHMKATSLWHG
Download sequence
Identical sequences K3XDL2
PYU1_T015311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]