SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI01G03140.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI01G03140.1
Domain Number 1 Region: 130-194
Classification Level Classification E-value
Superfamily RING/U-box 2.78e-21
Family RING finger domain, C3HC4 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OMERI01G03140.1
Sequence length 207
Comment pep:novel chromosome:ALNW00000000:1:2551236:2553624:-1 gene:OMERI01G03140 transcript:OMERI01G03140.1 description:""
Sequence
MKKSEGAKRKRKKEEEEGESVQWCYFIFPPPPPAFDITGSSSDDSSGPTFSPLVIAIIGV
LASAFLLVSYYTIISKYCGTFSSLRNRLLGSSAHRGGGGGADGGDNSRSQEPWSVALLDG
MDETLINKITVCKYRRGDGFVDSTDCSVCLGEFRDGESLRLLPKCSHAFHVLCIDTWLKS
HSNCPLCRCNIAFVTVGMVIAANLALK
Download sequence
Identical sequences OMERI01G03140.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]