SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI01G30720.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI01G30720.1
Domain Number 1 Region: 17-124
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000000105
Family SGL-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI01G30720.1
Sequence length 130
Comment pep:novel chromosome:ALNW00000000:1:31968860:31969252:1 gene:OMERI01G30720 transcript:OMERI01G30720.1 description:""
Sequence
MRATLRPTAAATALALILFLVVFSPSPAAAAAARMFKTIDARRSRHLDLGGSLVGPESVA
FDGKGRGPYSGVSDGRIMRWNGEAAGWSTYTYSPSYTKNKCAASTLPTVQTESKCGRPLG
LRFHFKTPTN
Download sequence
Identical sequences OMERI01G30720.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]