SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI04G10320.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI04G10320.1
Domain Number 1 Region: 35-70
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000709
Family Thioltransferase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI04G10320.1
Sequence length 74
Comment pep:novel chromosome:ALNW00000000:4:16924398:16926100:-1 gene:OMERI04G10320 transcript:OMERI04G10320.1 description:""
Sequence
MDQRGGCSTFQRHTHHHSRRAAANDGPQHVLMLQVVANFSASWCGPCRVIAPIYTEMSKT
YPQLMFLTIDMLMT
Download sequence
Identical sequences A0A0E0DE87
OMERI04G10320.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]