SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI11G15270.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI11G15270.1
Domain Number 1 Region: 98-198
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000067
Family Thioltransferase 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI11G15270.1
Sequence length 213
Comment pep:novel chromosome:ALNW00000000:11:19929625:19932511:-1 gene:OMERI11G15270 transcript:OMERI11G15270.1 description:""
Sequence
MGAAAKPPPFVCFKWPWGPDPKATSPSPSPSPCGDLEMPWLLKSIRTVAQGLLIAGDLPS
PSSDGGGGGGGARTRGRRRRRLGPGLAAEADRGEAEQRALAAALASGRDATVLEFYSPRC
RLCASLQGLVRELEDGAGGRAGFVLADAEDDRWLPELLHYDIRYVPCFVLLDKNGRALAK
TGVPTSRQHVIAGLHHLLNMNQISVQEGTKSTA
Download sequence
Identical sequences A0A0E0F7C2 A0A0E0J3U2 B8BEB0
OMERI11G15270.1 39946.BGIOSIBCE029446 OsIBCD028042 ONIVA11G18340.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]