SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI12G14490.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI12G14490.1
Domain Number 1 Region: 9-81
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0000085
Family SGL-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI12G14490.1
Sequence length 160
Comment pep:novel chromosome:ALNW00000000:12:19365357:19365839:-1 gene:OMERI12G14490 transcript:OMERI12G14490.1 description:""
Sequence
MPASFEALSWARDPCASPSSLLFSSSSSPGRHYYWSWKNVADTPPPFGEEEAVTAYAVHP
DGRTIFVSTGGGTYSFDTGRRHGDWVLPFRGQGYFDGELDAWVGLHREVRGRVCACQVAS
RGGARPPEYRETLDYDSVSSSRSKNRRQRATLTYKGDCMF
Download sequence
Identical sequences A0A0E0FEL3
OMERI12G14490.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]