SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI01G01840.2 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI01G01840.2
Domain Number 1 Region: 483-778
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.46e-58
Family Protein kinases, catalytic subunit 0.00026
Further Details:      
 
Domain Number 2 Region: 59-150
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000000131
Family alpha-D-mannose-specific plant lectins 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OMERI01G01840.2
Sequence length 781
Comment pep:novel chromosome:ALNW00000000:1:1450600:1453009:1 gene:OMERI01G01840 transcript:OMERI01G01840.2 description:""
Sequence
MMEPLLTLLVLLLVFAIAPSKAQSITLGSLLTTEGVNTSWISPSGDFAFGFQLISTNTYL
LAVWFNKTVDKSMAWYAKTNTQVPEVVLVPSGSRLQLSSNGLSLLDPGGHELWNPQVPGA
AYANMLDTGNFVLLGADGSTKWGTFDSPADTILPTQGPFSEVQLYMKDGNLEFDLVAVPS
GNKYRSYLTPNTGGNGSQLLFNETGGVYFTLKDGTEITITSTIMGSMVNYYQRATLHPDG
VFRQYVYPKKEAVTRGWKYIGWTAVDFIPRNICDVFTTSDGSGACGFNSYCSFNWNQNET
VECQCPPHYSFIDEARKYKGCKANFQQQSCDLDEATMIHEFDLIPMKGIDWPSADYESFT
SVGMDDCQKLCLTDCFCAVTVFNEGNCWKKKLPMSNGRMDSSVDRTLYLKVPKNNNSLSI
INTGSIKWKKDKKYWILGSCLLLGSFLLVLILLISFILFGHYFAKKSKKIDPPKQSYSTG
GLPLKSFTYEELHEATGGFCEEIGSGGSGVVYKGTLQDQLGTHIAVKKINKVLPDIEKEF
AVEVQTIGWTFHKNLVRLLGFCNEGAERLLVYEFMPNGPLNEFIFCTIRPSWYQRGWQED
CSTCMRNAAHRSSTDIKPQNILLDNNLTAKISDFGLAKLLQMDQTQTTAGIRGTRGYVAP
EWFKNIAVTAKVDVYSFGVILLEIVCCRRNVEQDIIDEDRAILTEWANDCYRSGRIDLLV
EGDEEASFDIKRVQRFLAVALWCIQEDPAMRPTMHKVTQMLDGAVEIAVPPDPAPYISSL
Q
Download sequence
Identical sequences A0A0E0BWN7
OMERI01G01840.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]