SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI01G01840.3 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI01G01840.3
Domain Number 1 Region: 462-754
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-75
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 59-204
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000000249
Family alpha-D-mannose-specific plant lectins 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI01G01840.3
Sequence length 774
Comment pep:novel chromosome:ALNW00000000:1:1456899:1460577:1 gene:OMERI01G01840 transcript:OMERI01G01840.3 description:""
Sequence
MEHLFTLIFLLVFTVAPSKAQRNITKGSFLTTEGVNTSWVSPSGDFAFGFQLINGNNSYL
LAVWFDKTVDKTLAWYAKTNTQVPELVVVPSGSRLQLSSNGLSLLDPGGHELWNPQVTSA
AYASMLDTGNFVLAGADGSIKWGTFDSPADTILPTQGPFSEVQLYSRLTPTDYSNGRFLL
QVKDGNIEFDLVAVPSGNVYWPYWNPNTAGNGTQLLFNATGRVYFTLQDGTEINITSTIM
GSMGDYYQRATLDPDGVFRQYVYPKKEAARKWNNIVWTTVDFIPRNICQAIRSPDGSGAC
GFNSFCSFNWNLNEIVDCKCPPHYSFIDQALKYKGCKADFQPQSCDLDEETMIDQFDLIP
MNGVDWPLADYEHYTSVGMDECKKLCLTDCFCAVVVFNNGDCWKKKLPMSNGRLDSSVDR
TLYLKVPKNNDTQSQLNSNSIKWKKEKKHWILESKKTDLPKQSSSTGGLPLKSFTYEELH
EATDGFSEEVGRGGSGVVYKGQLQDPLGTYVAVKKIDRVMPDIEKEFAVEVQTIGWTFHK
NLVRLLGFCNEGAERLLVYEFMPNGSLTGFLFDTVRPSWYLRVQFAIGVARGLLYLHEEC
STQIIHCDIKPQNILLDNNLTAKISDFGLAKLLRMDQTQTHTGIRGTRGYVAPEWFKNIA
ITAKVDVYSFGVILLEIICCRRNVEKDMTNDDRAILTDWANDCYRSGRIDLLVEGDEEAS
FDIKRVQRFLAVALWCIQEDPAMRPTMHKVTQMLDGAVEIAMPPDPASYISSLQ
Download sequence
Identical sequences OMERI01G01840.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]