SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI01G03390.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI01G03390.1
Domain Number 1 Region: 489-819
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-77
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 
Domain Number 2 Region: 64-168,200-231
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.72e-23
Family alpha-D-mannose-specific plant lectins 0.0059
Further Details:      
 
Domain Number 3 Region: 365-437
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00000961
Family Hairpin loop containing domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI01G03390.1
Sequence length 830
Comment pep:novel chromosome:ALNW00000000:1:2673727:2676219:-1 gene:OMERI01G03390 transcript:OMERI01G03390.1 description:""
Sequence
MPPLLYNLFVLIVVFLGGGAPACSAATDTVTPGHVVGGEDKVVSNNGKFALGFFKAPAPN
QDKWFLGIWFNTVPNRTTVWVANGGEPIMDADAAGSPELTISGDDGDLVALHPTTKSIAW
STSVSAKNTTSNSNTAAVLLNSGNLVLQDTSNMSQPRTLWQSVDHPTDTLLPGAKLGRDK
LTGLNRRLVSKKSMAGPSPGAYCFEVDEDTPQLVLKLCNSSITYWSSGPWNGQYFTGIPE
LIGNSPGFHLGFFDNSREEYLQFNVSNEAVVTRNFIDVDGRNKQQVWLDSSQSWLTLYSN
PKVQCDVYGVCGAFSVCSFSLLQLCSCMKGFTVGSVKDWEQGDQTGGCVRKNQLDCVGSN
TSSSDSTDKFYSMSGIILPDKAESMKDIDSSDECMKVCLNNCSCTAYSYGSKGCLVWHTE
LLNAKQQQQNSNGEIMYLRLSERDMQRSKKRRVIIGVVVGACAASLAVLMFILMFIIRRN
KDMNRSENYGSIVAFRYKDLRSATKNFSEKIGEGGFGSVFRGQLRDSTSIAVKRLDGRSQ
GEKQFRAEVRSIGTIQHINLVNLIGFCSDGDSRFLVYEHMPNRSLDTHLFQSNGKFLDWN
TRYQIALGVARGLCYLHESCHDRIIHCDIKPQNILLDASFLPKVADFGMAKFVGRDFSRA
LTTMRGTIGYLAPEWISGTAITPKVDVYSYGMVLLELVSGRRNSARSEEECTTTTTTSTS
TDTDGNYSVYFPVQASRKLLDGDVMSLLDQKLCGEADLKEVERVCKIGCWCIQEDEVDRP
TMGQVVQILEGVLDCDMPPLPRLLQRIFERPSSVSTSTPVFLFVGSPERQ
Download sequence
Identical sequences A0A0E0BXB3
OMERI01G03390.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]