SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI01G07690.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI01G07690.1
Domain Number 1 Region: 446-568
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.97e-29
Family Protein kinases, catalytic subunit 0.002
Further Details:      
 
Domain Number 2 Region: 89-160
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000236
Family alpha-D-mannose-specific plant lectins 0.0095
Further Details:      
 
Weak hits

Sequence:  OMERI01G07690.1
Domain Number - Region: 330-374
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0212
Family Hairpin loop containing domain 0.041
Further Details:      
 
Domain Number - Region: 127-247
Classification Level Classification E-value
Superfamily NHL repeat 0.0523
Family NHL repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI01G07690.1
Sequence length 673
Comment pep:novel chromosome:ALNW00000000:1:6747000:6749285:1 gene:OMERI01G07690 transcript:OMERI01G07690.1 description:""
Sequence
MEIAINWRYLFSPSSVIIFPFLINFIHPDSKLIFSRDSLLPGQSLNANQTLVSRNGAFKL
GFNFSVSAYHISYCDVNIWFINSSSCSYDHFPVWQPDLYCRDSSSISLSEKGILQINDCY
NMSTTYISAVAVLLDNGNLVIRDQVNNSMVLWQSFDNPTGILISGGRLGFNSITGNNVSL
SYRSKLDPLVYTLTLDATKRRGFIIQLNPISLTFSGTFPRWIDIHEDGDYALTLNGTNTY
MHLNSSGFIEFGKQDVCSSVLWSAPESLCDFDSYCGPYSLCTRSGSCICPIGFDPPSTVE
WIAVGCSRKVPMNCKMGFYPIDGVYKFPQNSWPSDARSMKQCEASCTRDCTCIAFAYNTT
CLLWFVELRNTVVLDSGSNGNRLYIRIDTSQQQNSGSRGAPQFSNQKKAIVLSVMGMIAV
IAIILIFLWRCQTKLLTAKPVYENEILMVFSFTQVKNSTKNFSEKLGEGGFGSVFKGTIL
DSMTVAVKKLKDLRQGEKQFRAEVQTVGMIQHNNLVRLLGFCADGSNRLLVYEYLTNGSL
NSHLFSGSSANLLSWELRHQIALGTARGRRNSEKIKEGRHTYFPIYVACKVNEGDVMCLL
DSRLKGNADAEQLARACRIACWCIQDAEDHRPMMGQVVHMLEGVIDVGVPPVPRSLQYFV
GMEDNNTQSAECN
Download sequence
Identical sequences OMERI01G07690.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]