SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI01G07740.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI01G07740.1
Domain Number 1 Region: 325-611
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.32e-78
Family Protein kinases, catalytic subunit 0.0000938
Further Details:      
 
Domain Number 2 Region: 1027-1292
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.74e-56
Family Protein kinases, catalytic subunit 0.00052
Further Details:      
 
Domain Number 3 Region: 733-894
Classification Level Classification E-value
Superfamily L domain-like 4.54e-34
Family Polygalacturonase inhibiting protein PGIP 0.0014
Further Details:      
 
Domain Number 4 Region: 6-65
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000222
Family alpha-D-mannose-specific plant lectins 0.01
Further Details:      
 
Weak hits

Sequence:  OMERI01G07740.1
Domain Number - Region: 217-258
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00628
Family Pan module (APPLE domain) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OMERI01G07740.1
Sequence length 1325
Comment pep:novel chromosome:ALNW00000000:1:6791152:6801860:-1 gene:OMERI01G07740 transcript:OMERI01G07740.1 description:""
Sequence
MKNASDTAVAVILNTGNFVVRDQLNSSMVVWQSFDHPADALLPGAWLGLDMVIGANILLT
LYKSTYNCTLMIDQSRKRGFIMFIDGHDYLGTFPDWMVTYEENGSLVRLNDPEIPNEIEF
MKLHLGQVSLLKWINNATSSGWQPVWSYPSSCKVSAFHCGAFGICTSTGTCKCIDGFSPK
EPSEWELGHFVSGCSRITPSNCQGAVSTDSFVLLDNLQGFPDNPQNVTAATSEECQAACL
SECYCAAYSYHSGCQIWHIMLLNLTLADNPPYTEIYMRIGSPNKSRLHILVFILIFGSIA
VILVMLMLLLIYKNRSSCVASQAKMEGFLAVYSYAQVKKATRNFSDKLGEGSFGSVFKGT
IACSTIVAVKKLKGLGHIEKQFRTEVQTVGMIQHTNLVRLLGFCTGGTRRFLVYEYMPNG
SLDSHLFSETSRVLSWNLRHQIVIGIARGLAYLHEECRDSIIHCDIKPENILLDAELCPK
IADFGMAKLLGREFSAALTTIRGTIGYLAPEWISGQPITHKADVYSFGVLLFEIISGRRS
TEKIRYGNHRYFPLYAAAKVNEGDVLCLLDDRLEGNASLKELDVACRVACWCIQDDEIHR
PSMRQVIHMLESVVGVELPPIPASFQNLMDGDKNGSQQRRGFKPEALTIPCQSRCRFDSS
PSNLHHHNLLRSKPTRTLPRFCCFSAMPPPRLLCLAAFLALAAVVCAAEPDADRAALLDF
LAGLGGGRGRINWASSPRVCGNWTGVTCSGDGSRVVALRLPGLGLSGPVPRGTLGRLTAL
QVLSLRANNLSGEFPEELLSLASLTGLHLQLNAFSGALPPELARLRALQVLDLSFNGFNG
TLPAALSNLTQLVALNLSNNSLSGRVPDLGLPALQFLNLSNNHLDGPVPTSLLRFNDTAF
AGNNVTRPASASPAGTPPSGSPAAAGAPAKRRVRLSQAAILAIVVGGCVAVSAVIAVFLI
AFCNRSGGGGDEEVSRVVSGKSGEKKGRESPEYKAVIGKAGDGNRIVFFEGPALAFDLED
LLRASAEVLGKGAFGTAYRAVLEDATTVVVKRLKEVSAGRRDFEQQMELVGRIRHANVAE
LRAYYYSKDEKLLVYDFYSRGSVSNMLHGKRGEDRTPLNWETRVRIALGAARGIAHIHTE
NNGKFVHGNIKASNVFLNNQQYGCVSDLGLASLMNPITARSRSLGYCAPEVTDSRKASQC
SDVYSFGVFILELLTGRSPVQITGGGNEVVHLVRWVQSVVREEWTAEVFDVELMRYPNIE
EEMVEMLQIAMACVSRTPERRPKMSDVVRMLEDVRRTDTGTRTSTEASTPVVDVQNKAES
SSAAH
Download sequence
Identical sequences OMERI01G07740.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]