SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI01G07790.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI01G07790.1
Domain Number 1 Region: 478-765
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.58e-80
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 115-201
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000131
Family alpha-D-mannose-specific plant lectins 0.0082
Further Details:      
 
Weak hits

Sequence:  OMERI01G07790.1
Domain Number - Region: 374-416
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0981
Family Anti-platelet protein 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI01G07790.1
Sequence length 804
Comment pep:novel chromosome:ALNW00000000:1:6841502:6843916:-1 gene:OMERI01G07790 transcript:OMERI01G07790.1 description:""
Sequence
MAADGDGDGELARRVRSPSSRGRMAPPLAFLLVLLLLLAGGGGGAFLAAAASTDTIVPGK
GMAGNQTLVSKNGRFELGFFTPGSGIHYFLGVRLRNMAEYSPTFWIGDRVGVIDLPGVSL
EVFGDKLYIKEDGVSLWWSSVAGNGSSSDGGAVAAAVLLDTGDLVVRDQGNPSRVLWRSF
DYPGDSLLPGGRLGLDAATWTNVSLTFKGFSHNGSLQVDASRRNGFLLTTDGIDSRGAFP
DWMVTSQDNGSSLVLNHPDAPNSTEFLQFNLGLISLMRWSDSTAGWVARWTFPSDCKSGA
FFCGDFGACTAGGGGGCECVDGFTPSYPDEWRLGYFVTGCSRSLPLSCEANGQTEHDDSF
AILDNLRGLPYNAQDEPVTTDEDCRAACLNKCYCVAYSNESGCKLWYHNLYNLSSADKPP
YSKIYVRLGSKLKSNRGLATRWIVLLVVGSLAVTSAILALLLLCRYRTDLFASSKFEVEG
SLIVYTYAQIRKATGNFCDKLGEGGFGSVFRGTLPGSTTVVAVKNLKGVGQAEKQFRTEV
QTVGMIRHTNLVRLLGFCVNGNRRLLVYEYMSNGSLDAHIFSEKSRLLSWHVRYQIALGI
ARGLAYLHEECEDCIIHCDIKPENILLDYEFCPKICDFGMAKLLGREFNSALTTVRGTMG
YLAPEWIYGQPITKKADVYSFGIVLFEIISGRRSTETVKFGSHRYFPTYAAVQMNEGDVL
CLLDSRLEGNANVKELDITCRVACWCIQDEENDRPSMGQVVRMLEGVVDMEMPPIPASFQ
NLMESEGSGIYSEESWNFRTRDQF
Download sequence
Identical sequences OMERI01G07790.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]