SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI01G22820.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI01G22820.1
Domain Number 1 Region: 475-766
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-69
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 62-199
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.88e-27
Family alpha-D-mannose-specific plant lectins 0.0027
Further Details:      
 
Weak hits

Sequence:  OMERI01G22820.1
Domain Number - Region: 328-379
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0011
Family Anti-platelet protein 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI01G22820.1
Sequence length 781
Comment pep:novel chromosome:ALNW00000000:1:25049396:25051741:1 gene:OMERI01G22820 transcript:OMERI01G22820.1 description:""
Sequence
MARLLCLVTLPLISVLPFSYSSPLLMLSTGSSLFVEEHKQTFLTSPNADFSCGFYEVGGN
AFSFSIWFTNSKNRIVVWSANPKSPVNGHGSKVTLNHEGNLVLAGVNGTANWDSKTSSGK
GTTAVLLDTGNLVIRDSTGTKLWQSFWAPADTLLPLQPLTKGTRLVSGYFNLYFDNDNVL
RLMYDGPEISSIYWPSPDYSVFDIGRTSYNGSRNAILDTEGHFLSSDKLDIKAADWGAGI
NRRLTLDYDGNLRMYSLNASDGSWNVSWQAIAKLCDVHGLCGENGICEFLPSFKCSCPPG
YEMRDPTNWSRDCRPLFSKNCSKIEEYEFVKLAQTDFYGFDLIINQSISLKECKKTCLDI
CSCSAVTYKTGSGTCYIKYVLFNGYSSTNFPGDNYIKLPKNMVSKQSDLSCNPSKEIVLG
SSSMYGMNDANKNYATYYVFAAVLGALVLIFTGTSWWFLYNKHNIPMSMEAGYRMVTSQF
RMFTYRELREATGKFKEEIGRGASGIVYRGVLEDKRVIAVKRLMNISHGEEEFWAEMSII
GRINHMNLVRMWGFCSEGQQKLLVYENVDNESLDKYLFGDVSAERLLAWSQRFKIALGTA
RGLAYLHHECLEWVVHCDVKPENILLTRDFEVKIAEFGLAKLSKRDSTSLNFMHMRGTMG
YMAPEWALNSPINAKVDVYSYGVVLLEIVTGSRISSGIKVDGREVELRDFVQAMKHILAT
GDVKDVIDTRLNGHFNSEQAKVVVDVAISCLEERNSRPTMDEIAKAFLACDDQDNHPAYS
W
Download sequence
Identical sequences A0A0E0C5U2
OMERI01G22820.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]