SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI01G22830.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI01G22830.1
Domain Number 1 Region: 501-804
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-69
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 65-204
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.23e-27
Family alpha-D-mannose-specific plant lectins 0.0026
Further Details:      
 
Weak hits

Sequence:  OMERI01G22830.1
Domain Number - Region: 347-391
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00706
Family Hairpin loop containing domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI01G22830.1
Sequence length 818
Comment pep:novel chromosome:ALNW00000000:1:25061012:25063468:-1 gene:OMERI01G22830 transcript:OMERI01G22830.1 description:""
Sequence
MAGLVIGYLAVQLSLMSLLLCPSSSTAQHTLGRSSMSVEDHERPFLVSTDGSFSCGFLEA
GDNAFTFSVWFTADPNRTAVWSANRDAPVNGRGSRVSFSRDGELALVDTNGTTVWSSKTT
GTGNRRGLTVSLRDTGNLVVGDPSTGLAVWQSFDWPTDTLLPSQRFTKQTKLVAGYFSLY
FDNDNVLRMLYDGPEIASIYWPLPGLTVFENGRTNYNSTRIAILDDAGVFLSSDQTKAEA
TDLGLGIKRRITIEQDGNLRMYSLNASTGGWEVTWSALKQPCQAHGLCGKNGLCEYLPSL
RCSCLPGYVMVDRQDWRRGCKPTFPVGNCSQGSAPSPAPAPAQAQFKFIEVAQTDFFGFD
LGYTVSITFKQCRDQCMNNCQCTAFSYRLDGRGRCYPKGTLFNGFTSANFPGSIYLKVPL
DFNASSPRVSAQRAAGLACGANVTVVTVSADVYGMAPGSNGQWTYFFVFAGVLGVLDILF
IATGWWFLSSKQSIPSSLQAGYKMVMTSQFRRFTYRELKGATANFKEELGRGGSGAVYRG
VLDGGKVVAVKRLAVDVTMQGDEEFWSEMTVLGRINHINLVRIWGFCSERKHKLLVYEYV
ENQSLDRHLFDASDGSGGKATTLAWSDRYKIALGTARGLAYLHHECLEWVIHCDVKPENI
LLTREFEAKIADFGLAKLSKRDGGAGVELTHMRGTSGYMAPEWALNLPINAKVDVYSFGI
VLLEIVVGSRVADQRTEAGEPLQLPQITQALRHVVDSGDVMSLVDARLQGQFNPRQAMEM
VRISLACMEERSSRPTMDDIAKSLTAFDDEDEHPAYHS
Download sequence
Identical sequences A0A0E0C5U3
OMERI01G22830.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]